SecReT4
Protein ID: 295788829
T4SS name [ID]Trb [54]
Gene symbol-
Locus tagpEP5289_p20
StrainNeisseria gonorrhoeae plasmid pEP5289 (NC_014105)
Repliconplasmid pEP5289 [GenBank: NC_014105] [Browse all T4SS(s) in this replicon]
Location [Strand]15676..17304 [-]
ProductTrbL
Component typeTrbL
UniProt IDD5K9H3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 4.8e-30, Aligned region: 69..280
Protein Sequence: 542 a.a.     [Download]
>gi|295788829|ref|YP_003600444.1| TrbL [Neisseria gonorrhoeae]
MQYITQIMKKKYIYYFIFFITLSMPIISHAAGQGGVLDEALSRYEGKIGAWEAAFYKAGLFIFWSLSSIS
IVMTGAQLIFQRDNISSFFAEFTRLILFLGFFLWIITNGIKITTSIKDGLMKLAGQASRNGEQITPSSIV
DIGFNLFDKIVENSSIWDPIDSATLIVIGLVILLILAAVGINMLLMLITTYIVIYSGIIILGFGGGRWTS
DMAVGYLKQVLNLSLQLAAMILIIGIGQSIVQDTINTIGTPGFRELAVVLVQTALLVGLVVKIPPMIGSL
AGGAGSGGIGSFGVGNAIAAAAMLAGAAAGAGAALKSLAVEAGGLKKAFEAAKAGLGGSNGSSDSGSGKM
DSAVDAVAGANAGDKSNQDGKPLTAESSGNSENGSEGSTTGNSGGNPSGSSEENTISSGSSSSSGEANST
NTSASSGAEGSAEGEATSSETSQSASDSPSNNSGEATQTADTTPKTTNTGGGSPLATAMGGNKVSNWQAA
KNVAVGLVSSKWNNAVNNSAGGRLVKHWEDEKKKTEDPTKNPQKNPEGDDNA
 
Nucleotide Sequence: 1629 bp     [Download]
>gi|295788810|ref|NC_014105.1|:c17304-15676 Neisseria gonorrhoeae plasmid pEP5289, complete sequence
ATGCAATATATAACCCAAATTATGAAAAAAAAATATATTTATTATTTTATATTTTTTATAACGCTCTCTA
TGCCAATTATCTCTCATGCAGCAGGTCAAGGAGGAGTTTTAGATGAGGCATTATCACGCTACGAAGGTAA
AATCGGAGCGTGGGAAGCAGCATTTTATAAAGCTGGATTATTTATATTTTGGTCATTATCTTCAATTAGT
ATTGTAATGACTGGAGCCCAACTGATTTTCCAGAGAGATAATATCAGCAGTTTTTTTGCTGAATTTACTC
GTTTAATTTTATTCTTAGGATTTTTCCTTTGGATTATCACAAACGGAATTAAAATTACGACATCAATTAA
AGATGGTTTAATGAAACTTGCAGGACAAGCTAGTAGAAATGGTGAGCAGATTACACCTAGTAGTATTGTT
GACATAGGTTTTAATTTATTTGACAAAATTGTTGAAAATAGCTCAATCTGGGATCCAATTGATAGTGCCA
CTCTTATTGTTATTGGTTTAGTTATTTTACTAATCTTAGCTGCTGTCGGAATTAACATGTTATTAATGTT
AATAACAACCTATATTGTCATCTATTCAGGAATAATTATCTTGGGATTCGGCGGTGGACGTTGGACATCA
GATATGGCTGTCGGATATTTAAAACAAGTATTAAACTTATCTTTACAATTAGCAGCTATGATTCTAATTA
TTGGAATAGGTCAATCGATTGTTCAAGACACTATAAACACTATAGGAACCCCTGGATTTAGAGAACTAGC
AGTTGTTCTAGTTCAAACAGCTTTACTTGTTGGTTTAGTCGTTAAAATTCCTCCAATGATAGGTTCCCTA
GCAGGAGGAGCAGGAAGTGGAGGAATTGGCTCCTTTGGTGTAGGTAATGCTATTGCTGCTGCTGCTATGT
TGGCAGGTGCTGCTGCCGGAGCAGGTGCGGCATTAAAAAGCTTAGCCGTAGAAGCTGGTGGTTTAAAGAA
AGCATTTGAAGCTGCAAAAGCAGGCTTGGGAGGTTCAAATGGCTCATCAGATTCAGGTAGTGGGAAGATG
GATAGCGCAGTTGATGCCGTTGCAGGTGCAAATGCCGGAGATAAATCTAACCAAGATGGAAAACCACTGA
CTGCTGAGTCCAGTGGTAACTCAGAAAATGGTAGTGAAGGATCTACTACAGGAAATTCGGGAGGTAATCC
ATCAGGCTCCTCCGAAGAAAATACAATTTCATCCGGAAGCTCCTCAAGTTCGGGGGAAGCAAATTCAACA
AATACATCCGCTTCATCAGGAGCGGAAGGTAGTGCCGAAGGGGAGGCTACTTCATCAGAGACATCTCAAT
CAGCTTCTGATTCGCCAAGCAATAATAGCGGAGAGGCGACTCAAACGGCTGACACCACACCAAAAACAAC
TAATACCGGTGGAGGAAGTCCTCTTGCTACTGCGATGGGTGGTAATAAAGTATCAAATTGGCAGGCGGCA
AAAAACGTTGCTGTCGGCCTTGTTAGCAGCAAATGGAACAATGCCGTCAATAACTCTGCCGGTGGCCGCC
TAGTCAAACACTGGGAGGACGAAAAGAAAAAAACAGAAGACCCCACAAAAAATCCCCAAAAAAACCCTGA
AGGAGATGACAATGCTTAA
 Primer design