SecReT4
Protein ID: 295788834
T4SS name [ID]Trb [54]
Gene symbol-
Locus tagpEP5289_p25
StrainNeisseria gonorrhoeae plasmid pEP5289 (NC_014105)
Repliconplasmid pEP5289 [GenBank: NC_014105] [Browse all T4SS(s) in this replicon]
Location [Strand]20157..21023 [-]
ProductTrbG
Component typeTrbG
UniProt IDD5K9H8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 5.9e-58, Aligned region: 70..285
Protein Sequence: 288 a.a.     [Download]
>gi|295788834|ref|YP_003600449.1| TrbG [Neisseria gonorrhoeae]
MKRQILSLALITALSTSAFADSYADKYFEGSHNPKLNRHEQKGLGIAKNYSSDGRMAVPPVPGDNGRITF
AFGSDPSVVCAVMQVCDIALQPGEMINDLHAGDTARWNITPAISGSNGNERMHILVKPLDVGLQTTLFIA
TDRRTYHIRLKSHRTRYMPAVGFSYPEDTAARWRAIRANQARQAEAQVLPTGENIQNLDFNYTISGHNPS
WKPLRVYNDGTRTIIQMPPTLSQGEAPALLVVRNGENTLVNYRLHEDRYIVDSLFDEAIMITGVGRHQTK
VVIRRSRS
 
Nucleotide Sequence: 867 bp     [Download]
>gi|295788810|ref|NC_014105.1|:c21023-20157 Neisseria gonorrhoeae plasmid pEP5289, complete sequence
ATGAAAAGACAGATTTTATCCTTGGCGTTAATCACCGCTTTGTCCACTTCCGCCTTTGCCGACAGCTACG
CCGACAAATATTTTGAAGGCAGCCACAACCCGAAGCTGAACCGCCACGAACAAAAAGGCTTGGGCATCGC
CAAAAACTACTCTTCTGACGGCAGGATGGCCGTACCGCCCGTTCCCGGCGATAACGGCCGCATCACCTTT
GCCTTCGGCTCTGATCCGTCTGTCGTCTGTGCCGTAATGCAGGTCTGCGACATTGCCTTACAGCCCGGCG
AAATGATTAACGATCTGCACGCCGGGGATACCGCACGCTGGAATATCACTCCGGCAATTTCCGGCAGCAA
CGGCAACGAAAGAATGCACATCTTGGTTAAACCACTGGATGTCGGTTTGCAAACGACGCTTTTCATAGCC
ACCGACCGCAGAACCTATCATATCCGCCTCAAATCACACCGTACCCGTTATATGCCTGCCGTCGGTTTTT
CGTATCCCGAAGACACCGCCGCGCGTTGGCGGGCGATCCGGGCAAACCAAGCCCGGCAAGCCGAAGCTCA
GGTTCTGCCCACCGGAGAAAACATCCAAAACTTGGATTTCAACTACACCATCAGCGGCCACAATCCGTCA
TGGAAACCTTTGCGCGTTTATAACGACGGCACCCGCACCATCATCCAAATGCCGCCGACTTTATCCCAAG
GGGAAGCTCCGGCCTTGCTGGTCGTCCGTAACGGCGAAAACACCTTGGTCAATTACCGGCTTCACGAAGA
CCGCTACATCGTTGACAGCCTGTTTGACGAAGCCATCATGATCACCGGCGTTGGCCGCCATCAAACCAAA
GTCGTTATCAGACGGAGCCGATCATGA
 Primer design