SecReT4
Protein ID: 295788838
T4SS name [ID]Trb [54]
Gene symbol-
Locus tagpEP5289_p29
StrainNeisseria gonorrhoeae plasmid pEP5289 (NC_014105)
Repliconplasmid pEP5289 [GenBank: NC_014105] [Browse all T4SS(s) in this replicon]
Location [Strand]24626..25009 [-]
ProductTrbC
Component typeTrbC
UniProt IDD5K9I2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.3e-20, Aligned region: 4..103
Protein Sequence: 127 a.a.     [Download]
>gi|295788838|ref|YP_003600453.1| TrbC [Neisseria gonorrhoeae]
MTLSQSQQKWLFFIGLAVFLLLMSSPALASQGQGGGLPYESWLNNLRQSVTGPVAFALSIIGIVVAGGVL
IFGGELNAFFRTLIFLVLVMALLVGAQNMMSSFFGGAEVTAAVQAAQHYLLPLASKG
 
Nucleotide Sequence: 384 bp     [Download]
>gi|295788810|ref|NC_014105.1|:c25009-24626 Neisseria gonorrhoeae plasmid pEP5289, complete sequence
ATGACTCTGAGTCAATCGCAACAAAAATGGCTGTTCTTCATCGGACTGGCCGTCTTCTTACTGTTAATGT
CCTCGCCCGCGCTCGCGTCGCAAGGGCAGGGTGGCGGTCTGCCCTATGAAAGCTGGCTGAACAATCTCCG
CCAGTCCGTTACCGGCCCGGTGGCTTTCGCCCTGTCCATCATCGGCATTGTCGTTGCCGGTGGCGTACTG
ATCTTCGGCGGCGAACTGAACGCGTTTTTCCGCACTTTGATTTTCCTTGTGTTGGTAATGGCTTTGCTGG
TAGGAGCGCAAAACATGATGTCCTCTTTCTTCGGCGGCGCGGAAGTTACCGCTGCCGTGCAGGCCGCACA
GCATTACCTTCTTCCCTTGGCGTCGAAAGGATAA
 Primer design