SecReT4
Protein ID: 295788855
T4SS name [ID]Trb [54]
Gene symbol-
Locus tagpEP5289_p46
StrainNeisseria gonorrhoeae plasmid pEP5289 (NC_014105)
Repliconplasmid pEP5289 [GenBank: NC_014105] [Browse all T4SS(s) in this replicon]
Location [Strand]38767..39279 [+]
ProductTraF
Component typeTraF
UniProt IDD5K9J9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 9.4e-33, Aligned region: 23..167
Protein Sequence: 170 a.a.     [Download]
>gi|295788855|ref|YP_003600470.1| TraF [Neisseria gonorrhoeae]
MLAMCLTAALLVTGYGLLYAAGFRINDTRSVAKGVYRISGEAVRRGSYITFCPPDTEVFRMARRRGYIRA
GFCPENYSGLMKFVAGIPGDNYRFTDEGLLINGRLLGGTRPLWQDGLGQPLPVFEGEGRLKDDEYILIGN
AVANSFDARYYGIVRREHIRDVVKPIWIEE
 
Nucleotide Sequence: 513 bp     [Download]
>gi|295788810|ref|NC_014105.1|:38767-39279 Neisseria gonorrhoeae plasmid pEP5289, complete sequence
ATGCTTGCCATGTGTCTGACCGCCGCATTGCTGGTAACAGGCTACGGGCTGTTATATGCAGCCGGTTTCC
GTATCAACGATACCCGCAGTGTGGCCAAAGGGGTTTACCGCATATCCGGCGAAGCGGTACGGCGCGGAAG
CTACATTACATTTTGCCCTCCCGATACCGAAGTTTTCCGAATGGCAAGAAGGAGGGGGTATATCAGAGCG
GGTTTTTGTCCGGAAAATTATTCCGGGTTGATGAAGTTTGTTGCCGGTATTCCCGGCGACAATTACCGTT
TTACCGATGAAGGGTTGTTGATTAACGGACGGCTGCTTGGCGGCACCCGGCCTTTATGGCAAGACGGGCT
AGGGCAGCCCTTACCGGTATTTGAAGGGGAAGGCCGTCTGAAAGACGATGAGTACATTTTGATTGGTAAT
GCGGTGGCCAATTCGTTTGACGCGCGTTATTACGGCATAGTCCGGAGAGAGCATATCCGTGATGTCGTAA
AACCGATATGGATAGAGGAGTAG
 Primer design