SecReT4
Protein ID: 295788867
T4SS name [ID]VirB [436]
Gene symbolORF8
Locus tagpXFRIV11_p08
StrainXylella fastidiosa plasmid pXF-RIV11 (NC_014111)
Repliconplasmid pXF-RIV11 [GenBank: NC_014111] [Browse all T4SS(s) in this replicon]
Location [Strand]7549..8847 [-]
ProductP8
Component typeVirB10
UniProt IDD5LLA5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.5e-63, Aligned region: 242..424
Protein Sequence: 432 a.a.     [Download]
>gi|295788867|ref|YP_003603463.1| P8 [Xylella fastidiosa]
MSKTIDFSNAGALPTLDAKTEVFGEPTSKAKSKTNVGKFLILGLVLMAFLFMVAGLLFYQKYKLAHPSVK
TPAKSDSLKPELASNNASLESDLIEKKKAEIKKKQEEEQAQIKAIEEAQAQARIQAETLAAANAAKRGQG
DSAQVQQQGNQPPRSPTPMERKMAGSVLLEKTGAKPKADAPLSENTSSSEKEQQQREVQARMAAMGMNQS
GGQSGGTDGLAGRLEPTVLQARLAAKLPNLDYLLKRGTTIPCALKTGIDTTLPGFVICNVLNNVYSANGK
VLLIERGATVFGEQQSQLKQGQERTFIVWTRIDNPNGVFANIDSPATDQMGYSGIPGYVDTHFWQRFGSA
IMLSLIKDFSQAYSQRVANRNNTGVTVNQPYANTTQSTQDMGAEALRNSINIPPTLVVLPATAVNVMVAR
DVSFENVFNLVE
 
Nucleotide Sequence: 1299 bp     [Download]
>gi|295788859|ref|NC_014111.1|:c8847-7549 Xylella fastidiosa plasmid pXF-RIV11, complete sequence
ATGAGTAAAACGATTGATTTTTCAAACGCGGGAGCATTACCCACGCTGGATGCAAAAACCGAAGTTTTTG
GCGAGCCGACCAGCAAGGCGAAGTCCAAAACAAATGTAGGCAAATTCCTCATCCTTGGTTTGGTGCTTAT
GGCGTTTTTATTCATGGTGGCAGGGCTTTTGTTCTACCAGAAGTACAAGCTGGCTCATCCATCTGTAAAG
ACACCCGCCAAGAGTGATTCATTGAAACCTGAGTTGGCTTCAAATAATGCATCGCTCGAAAGTGATTTGA
TTGAAAAGAAAAAGGCAGAAATCAAGAAGAAGCAAGAGGAAGAACAAGCTCAGATCAAGGCGATAGAAGA
AGCTCAGGCACAAGCGAGAATCCAAGCTGAAACCCTGGCTGCTGCCAATGCTGCAAAACGCGGTCAAGGC
GATTCTGCTCAAGTGCAGCAGCAAGGAAATCAACCACCACGCTCACCTACGCCGATGGAGCGGAAGATGG
CGGGCAGTGTGCTCCTGGAGAAAACAGGCGCAAAGCCAAAAGCCGACGCGCCGTTGTCAGAAAATACGTC
TTCTTCAGAGAAAGAGCAGCAGCAACGCGAAGTCCAGGCCCGCATGGCGGCAATGGGCATGAATCAAAGT
GGTGGCCAAAGTGGAGGCACTGATGGGCTTGCGGGGCGTCTGGAACCTACCGTCTTGCAAGCCCGTTTGG
CTGCAAAGCTGCCTAATCTTGATTATCTGTTGAAGCGCGGCACAACGATTCCTTGTGCGCTGAAAACTGG
CATTGATACGACGCTGCCCGGCTTTGTCATTTGCAACGTGCTCAACAACGTGTATTCAGCTAATGGCAAA
GTGTTGTTGATTGAGCGGGGCGCAACGGTCTTTGGCGAACAGCAATCGCAGCTCAAGCAAGGCCAGGAAC
GCACCTTTATTGTGTGGACGCGCATTGATAATCCCAATGGCGTGTTTGCCAACATCGACAGCCCAGCGAC
CGATCAAATGGGTTACAGCGGTATTCCTGGCTACGTAGATACCCATTTTTGGCAGCGTTTCGGCAGTGCC
ATCATGCTGAGTCTGATTAAGGATTTCTCGCAAGCCTATTCGCAGCGCGTGGCCAATAGAAACAATACCG
GTGTGACGGTCAATCAACCGTATGCAAACACTACCCAGTCCACCCAGGACATGGGGGCTGAAGCATTGCG
CAACTCTATCAACATCCCTCCCACTCTGGTGGTACTGCCTGCGACGGCTGTGAACGTCATGGTGGCGCGT
GACGTGAGTTTTGAGAATGTCTTTAACCTTGTTGAATGA
 Primer design