SecReT4
Protein ID: 295788868
T4SS name [ID]VirB [436]
Gene symbolORF9
Locus tagpXFRIV11_p09
StrainXylella fastidiosa plasmid pXF-RIV11 (NC_014111)
Repliconplasmid pXF-RIV11 [GenBank: NC_014111] [Browse all T4SS(s) in this replicon]
Location [Strand]8850..9629 [-]
ProductP9
Component typeVirB9
UniProt IDD5LLA6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 7.5e-57, Aligned region: 20..235
Protein Sequence: 259 a.a.     [Download]
>gi|295788868|ref|YP_003603464.1| P9 [Xylella fastidiosa]
MKKLTILLLACVANLAYANDPRIRTEIYNKSSVYNVHTQIGRASLIQLEDGESLEISPSSLLGIGDAEAW
NLGVRGNNIVLKPTQKMPQTNVIVVTNKRTYSFELLATAKDSMPTYILRFRYPDTEASKAAAEAKRVQTT
AAARAEKTVINTDYFWRGDNELLKPTAAYDDGRFTHLVYDHSGELPVFFKVLPDGTEALLNSNIDPEHKQ
TVVLHEVIRTVRARLGNQVIEIINRAYKLPKFNETGTSVPGAMRTDRDI
 
Nucleotide Sequence: 780 bp     [Download]
>gi|295788859|ref|NC_014111.1|:c9629-8850 Xylella fastidiosa plasmid pXF-RIV11, complete sequence
ATGAAAAAACTCACTATTCTGCTTCTGGCTTGTGTTGCCAATTTGGCTTATGCGAATGATCCACGCATTC
GCACTGAGATTTACAACAAGTCTTCTGTATACAACGTACACACTCAAATTGGCCGTGCTTCACTCATCCA
GCTTGAAGACGGCGAATCCTTGGAGATTTCTCCCTCTTCATTGTTGGGTATTGGTGATGCTGAGGCTTGG
AACCTTGGTGTGCGTGGTAACAACATTGTTTTAAAACCCACGCAGAAGATGCCGCAAACGAATGTGATTG
TAGTGACAAACAAACGTACATATTCGTTTGAATTGCTGGCTACAGCCAAGGATTCAATGCCCACGTATAT
TCTGCGATTCCGGTATCCAGATACAGAAGCCTCGAAAGCGGCTGCCGAAGCAAAACGAGTACAGACCACT
GCTGCGGCCCGCGCCGAAAAAACGGTTATCAATACGGATTACTTCTGGCGTGGTGATAACGAGTTATTGA
AGCCCACCGCCGCTTACGACGATGGGCGATTTACGCACCTTGTCTATGATCACTCGGGCGAGTTACCTGT
GTTCTTCAAGGTTCTTCCGGATGGTACAGAAGCATTGTTGAATAGCAACATTGATCCTGAGCACAAACAA
ACCGTGGTACTGCATGAGGTGATTCGCACCGTAAGGGCGCGCCTAGGCAATCAGGTTATTGAAATCATTA
ACCGTGCGTACAAGCTTCCAAAATTCAACGAAACCGGCACCAGCGTTCCTGGCGCTATGCGTACAGATAG
GGACATCTAA
 Primer design