SecReT4
Protein ID: 295788870
T4SS name [ID]VirB [436]
Gene symbolORF11
Locus tagpXFRIV11_p11
StrainXylella fastidiosa plasmid pXF-RIV11 (NC_014111)
Repliconplasmid pXF-RIV11 [GenBank: NC_014111] [Browse all T4SS(s) in this replicon]
Location [Strand]10340..11311 [-]
ProductP11
Component typeVirB6
UniProt IDD5LLA8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 4.3e-40, Aligned region: 42..264
Protein Sequence: 323 a.a.     [Download]
>gi|295788870|ref|YP_003603466.1| P11 [Xylella fastidiosa]
MDESAPITWLIGEINKIVSSGADAAASAIATTVTPLASICFGIYILLICLNYMRGAETEPVIDFGLRCAG
FAVIIGLGLNAANYTSMVIPVVTGVGSDLASAISGGTATAGTLDQLALHYFKILDEGYDLASNRPFPSNV
GPLIIYVLKAVFILIGLIPFLVAATLCLIIADVGSVMLAIVGPLYFAFLIFPATRQYFSSWLNTAFSYAL
IPIFVAVIATISVGLSKQMFSANDISFKAVFMASMGNLTLLFLLRQVGALASSLSAGGINVSMPGSANTL
RNAAQAARLGAKGIQQGGRTAINAGKAAGRWAENRFNSIRKAG
 
Nucleotide Sequence: 972 bp     [Download]
>gi|295788859|ref|NC_014111.1|:c11311-10340 Xylella fastidiosa plasmid pXF-RIV11, complete sequence
ATGGATGAATCAGCGCCAATTACCTGGCTCATTGGCGAAATCAACAAGATTGTGAGTTCTGGCGCTGATG
CCGCCGCGTCAGCCATTGCTACAACGGTCACGCCGCTGGCATCAATTTGCTTTGGGATTTACATCCTTCT
GATCTGCCTCAATTACATGCGTGGCGCAGAAACTGAGCCGGTGATTGATTTTGGCCTTCGGTGCGCGGGC
TTTGCGGTGATTATTGGCCTCGGTTTGAATGCCGCTAACTACACCAGCATGGTGATTCCTGTCGTAACGG
GTGTAGGCAGCGATTTAGCATCCGCGATCAGCGGTGGCACCGCGACGGCTGGCACACTGGATCAACTGGC
GCTGCATTACTTCAAGATCCTTGATGAGGGCTATGACCTTGCAAGCAACCGCCCGTTTCCGTCTAACGTT
GGGCCTCTGATTATCTACGTGCTCAAAGCCGTTTTCATTCTTATTGGTCTAATTCCGTTCCTTGTCGCCG
CAACGCTTTGTCTCATCATTGCTGATGTTGGCTCTGTGATGTTGGCTATTGTGGGTCCGCTGTACTTTGC
CTTTTTGATCTTTCCAGCGACGCGGCAATATTTCTCATCCTGGCTCAACACAGCGTTCAGCTATGCATTG
ATTCCTATATTTGTTGCAGTAATCGCCACCATATCCGTGGGGCTTTCAAAGCAAATGTTTTCGGCAAACG
ACATTTCTTTTAAAGCGGTATTCATGGCCTCCATGGGCAATCTGACGTTGCTGTTTCTGTTGAGACAGGT
CGGCGCTCTGGCGTCATCACTGAGTGCTGGCGGTATCAATGTATCAATGCCTGGAAGCGCTAATACGCTG
AGAAATGCGGCTCAGGCAGCCAGGTTGGGAGCAAAGGGCATCCAGCAAGGAGGGCGCACCGCCATTAATG
CTGGCAAGGCTGCTGGTCGCTGGGCAGAAAACAGATTCAATTCGATCAGGAAAGCAGGCTAA
 Primer design