SecReT4
Protein ID: 295788875
T4SS name [ID]VirB [436]
Gene symbolORF16
Locus tagpXFRIV11_p16
StrainXylella fastidiosa plasmid pXF-RIV11 (NC_014111)
Repliconplasmid pXF-RIV11 [GenBank: NC_014111] [Browse all T4SS(s) in this replicon]
Location [Strand]12679..13344 [-]
ProductP16
Component typeVirB5
UniProt IDD5LLB3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 3.7e-47, Aligned region: 29..208
DUF4141 [PF13605], Evalue: 8.1e-05, Aligned region: 14..49
Protein Sequence: 221 a.a.     [Download]
>gi|295788875|ref|YP_003603471.1| P16 [Xylella fastidiosa]
MSFTGILKKTRVSISAFVFVFAGAAHAQLQVYDAANISKSIANHAESIAKWKQQFEQLKQQIDQHQKQYE
AMTGSRGMGALLDNSALKASLPSDWKQVLSDVKKTSAYATERSKYPTSENLQKTNAMYDVIASQDVIMSD
LYSKANHRLSLIQSLTAQIDSANDPAAKADLANRLINEQNAIQANQNLVTILQAKQKQELEIASQAAVEE
LSCKEFKRSGC
 
Nucleotide Sequence: 666 bp     [Download]
>gi|295788859|ref|NC_014111.1|:c13344-12679 Xylella fastidiosa plasmid pXF-RIV11, complete sequence
ATGAGTTTTACGGGAATTCTGAAGAAAACCAGAGTGTCCATAAGCGCTTTTGTTTTTGTCTTCGCTGGAG
CTGCACATGCGCAACTCCAAGTTTATGACGCTGCAAATATCTCAAAAAGCATTGCAAACCATGCCGAAAG
CATTGCGAAATGGAAGCAGCAGTTCGAGCAGTTAAAGCAGCAAATTGATCAACATCAAAAGCAATACGAA
GCCATGACTGGCTCACGTGGCATGGGCGCTTTGCTGGATAACTCGGCACTGAAAGCCTCGTTGCCGTCTG
ATTGGAAACAGGTACTGAGTGACGTGAAGAAAACTAGCGCTTATGCCACTGAGCGCAGCAAATATCCGAC
CTCGGAAAATTTGCAAAAGACAAATGCCATGTATGACGTGATTGCGTCTCAAGACGTGATCATGAGTGAT
TTGTACAGCAAGGCCAATCACCGATTGAGTTTGATTCAATCGCTGACAGCACAGATTGATTCAGCCAATG
ATCCGGCGGCAAAAGCTGACTTAGCCAATCGCCTGATCAACGAACAAAACGCCATTCAAGCAAACCAAAA
CCTTGTGACCATTCTCCAAGCTAAGCAAAAGCAGGAGTTGGAAATCGCAAGCCAAGCTGCCGTAGAGGAG
TTGTCATGCAAAGAATTCAAACGTTCCGGTTGTTAA
 Primer design