SecReT4
Protein ID: 295788876
T4SS name [ID]VirB [436]
Gene symbolORF17
Locus tagpXFRIV11_p17
StrainXylella fastidiosa plasmid pXF-RIV11 (NC_014111)
Repliconplasmid pXF-RIV11 [GenBank: NC_014111] [Browse all T4SS(s) in this replicon]
Location [Strand]13347..15830 [-]
ProductP17
Component typeVirB4
UniProt IDD5LLB4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 2.3e-28, Aligned region: 182..387
AAA_10 [PF12846], Evalue: 1e-26, Aligned region: 452..724
Protein Sequence: 827 a.a.     [Download]
>gi|295788876|ref|YP_003603472.1| P17 [Xylella fastidiosa]
MATLNITAEQWRLLQQLTVVNSKMLSAILKKQFAGEEQLPPYNYHVRDTIVSLEDGRMAFILKAKGLPFE
MTSDNVLENQYDELNGLFLSLAKSTGSRLAVWAHIDHYAKTLKSNYEFSYEWIRLFTEKYMARFEGESIF
ENSFYLTFILKPGMNDSLEESIRELEEMQIIVTQTLASYKCEVLSIYDHNGHQFSQFYEFIAYLYNGFWE
RVPVTSLPLFQAVQTSALHHGYKLLETRFPNGGNRYSAFFDLKDFPEPTTRGKFNPLLELPFPFVMCLSF
TFINTADSIRLINQALNKMESAGDEATDQMKDMDFGKGAIMSGEVYFGELHGALAVYGKTEKQAEDRGAT
ALAALSGSCATRFVPATISAPETFFSMFPGNVKRRPRPMPKTTRNFLGLFSMNTYSSGKQYGNPVGDGSA
IMPLQTPAHGVYYLNFHYSPPDLDSRGEKVAGHLCIMGATGVGKTTLQTTALTFLHRMDYKLFAVDKDGS
MRGFIEAVGGTYFRLASGEPTGLNPFQLPDTRQNRNFLYDLVGACGRKVGQESTAEDTKDIKQAVDNVFA
MPFELRRFGVLLQSIPDRGENCLARRLADWCYGEMEGRYAYALDNPENNFDWQSFRRVGFDVSDFLVAGH
PATEPILSYLFHLKNLMQRDGGLLATVVEEFWLPLQYPTTANQILDSLKTGRRRGEFIMLVSQSPEDVIK
SQLLPAVLQQTPTKILLPNPDAEYTTPDGGGYSRFGLSIKEFQKLRKLGLQSRMFMIKQGSQSSLVKMNL
SGMAEDIAVLAMDAADFKYLEAAKAQAGAHPDQWVPAYKALRKKSRENVTQPVTVKE
 
Nucleotide Sequence: 2484 bp     [Download]
>gi|295788859|ref|NC_014111.1|:c15830-13347 Xylella fastidiosa plasmid pXF-RIV11, complete sequence
ATGGCAACGCTAAATATCACGGCGGAACAATGGCGATTGCTCCAACAACTTACGGTCGTAAACTCAAAAA
TGTTAAGCGCTATTTTAAAAAAACAGTTTGCGGGTGAAGAACAACTACCACCTTATAACTACCATGTTAG
AGACACGATCGTTTCTCTTGAAGATGGGCGTATGGCATTCATTCTCAAGGCAAAGGGTTTGCCTTTTGAA
ATGACGAGCGACAATGTATTAGAGAACCAATACGATGAGTTGAACGGACTGTTTCTGAGCTTGGCCAAGT
CAACAGGCTCACGTTTAGCGGTGTGGGCGCACATCGACCACTACGCAAAGACGCTTAAATCAAATTACGA
ATTTAGCTATGAATGGATTCGACTTTTCACAGAGAAGTACATGGCTAGGTTTGAAGGTGAATCTATTTTC
GAGAACAGTTTTTATCTGACATTCATTCTGAAGCCTGGGATGAATGACTCTCTTGAAGAGAGTATTCGTG
AGCTTGAAGAGATGCAGATCATCGTGACACAAACTCTTGCATCTTATAAATGCGAAGTTTTGTCAATATA
CGATCACAACGGCCACCAGTTCAGTCAGTTTTACGAGTTCATTGCGTACCTGTACAACGGCTTCTGGGAG
CGCGTTCCTGTCACCTCTCTTCCGCTGTTCCAGGCGGTACAAACAAGTGCTTTGCACCATGGTTACAAGC
TGCTAGAAACGCGGTTCCCAAATGGTGGAAATCGCTATAGCGCGTTTTTCGACTTAAAGGATTTTCCGGA
GCCAACAACGCGGGGAAAATTCAACCCGCTGTTAGAGTTACCGTTTCCTTTTGTCATGTGCTTGTCATTT
ACATTCATCAATACGGCTGACTCCATCAGGTTGATTAATCAGGCCCTGAATAAAATGGAATCTGCGGGCG
ATGAAGCCACTGATCAGATGAAAGACATGGACTTTGGCAAGGGTGCCATCATGTCTGGCGAAGTGTATTT
CGGTGAGCTGCATGGCGCGTTGGCCGTATACGGAAAGACTGAAAAGCAGGCCGAAGATCGGGGGGCTACG
GCTCTAGCTGCGCTCAGTGGTTCATGTGCAACCCGGTTCGTTCCTGCCACCATTTCAGCACCTGAAACGT
TCTTTTCTATGTTCCCAGGCAACGTCAAGCGCCGTCCGCGTCCGATGCCAAAAACGACCAGGAATTTTCT
TGGGCTGTTTAGCATGAACACGTACAGCTCAGGCAAGCAATACGGCAATCCTGTGGGTGATGGTTCAGCG
ATCATGCCGCTGCAAACACCGGCGCATGGTGTGTACTACTTGAACTTTCACTACTCGCCGCCCGATCTGG
ATTCTCGCGGTGAAAAGGTGGCAGGACACCTCTGCATTATGGGTGCAACTGGCGTTGGCAAGACAACGCT
TCAAACCACGGCGCTAACGTTCCTGCACAGAATGGATTACAAACTGTTCGCCGTGGATAAAGATGGATCT
ATGCGCGGCTTTATCGAAGCCGTGGGGGGGACGTATTTCCGGCTGGCCAGCGGCGAGCCTACGGGTTTGA
ATCCTTTCCAACTTCCAGATACGCGGCAAAACCGTAACTTTCTCTATGACCTGGTGGGTGCGTGTGGCCG
CAAAGTTGGCCAGGAGAGTACCGCAGAGGACACCAAGGACATTAAGCAGGCCGTAGACAATGTGTTTGCG
ATGCCCTTCGAGCTACGGCGCTTTGGCGTTCTATTGCAAAGCATCCCTGATCGTGGCGAAAACTGTTTGG
CTCGCCGCCTGGCTGACTGGTGCTATGGAGAGATGGAAGGACGTTATGCCTACGCCCTGGATAATCCTGA
AAACAACTTCGATTGGCAAAGTTTCAGGCGTGTTGGCTTCGACGTGTCTGATTTTCTGGTGGCGGGTCAT
CCGGCGACTGAGCCAATCCTGTCTTATCTCTTCCACCTCAAGAACTTGATGCAGCGCGATGGTGGGTTGC
TCGCCACGGTAGTTGAAGAGTTCTGGTTGCCTCTGCAATACCCCACAACGGCAAACCAGATTCTTGATTC
CCTGAAAACAGGTCGTCGCCGTGGCGAATTCATCATGTTGGTTTCACAGTCTCCAGAGGATGTGATTAAA
AGTCAGCTACTGCCTGCGGTGCTGCAACAGACACCCACAAAGATTCTTTTGCCAAATCCTGACGCTGAAT
ACACCACGCCTGACGGTGGCGGTTATTCCCGTTTTGGCCTGAGCATCAAGGAGTTCCAGAAGCTCAGGAA
ACTTGGGCTACAAAGCCGCATGTTCATGATAAAGCAGGGTTCGCAATCCAGCCTGGTTAAGATGAATTTG
AGTGGCATGGCTGAGGACATTGCCGTACTCGCAATGGATGCTGCGGATTTCAAGTATCTGGAGGCAGCCA
AGGCGCAAGCGGGCGCGCATCCTGATCAGTGGGTGCCTGCCTATAAGGCACTCCGTAAAAAAAGCCGTGA
AAACGTTACTCAACCCGTAACCGTGAAGGAGTGA
 Primer design