SecReT4
Protein ID: 295788877
T4SS name [ID]VirB [436]
Gene symbolORF18
Locus tagpXFRIV11_p18
StrainXylella fastidiosa plasmid pXF-RIV11 (NC_014111)
Repliconplasmid pXF-RIV11 [GenBank: NC_014111] [Browse all T4SS(s) in this replicon]
Location [Strand]15724..16107 [-]
ProductP18
Component typeVirB3
UniProt IDD5LLB5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 127 a.a.     [Download]
>gi|295788877|ref|YP_003603473.1| P18 [Xylella fastidiosa]
MTDEQSPEEYISYNGLGRSPMIWGIPYMAGLAIMCLSLLGGLLLGTFVASWGWLFSLIGVPMILFVKIIC
TNDDKAIRILMLEVKWSLLKALNGNAKYHGGTMAIAPTTYGRKLKNVKRYFKKTVCG
 
Nucleotide Sequence: 384 bp     [Download]
>gi|295788859|ref|NC_014111.1|:c16107-15724 Xylella fastidiosa plasmid pXF-RIV11, complete sequence
ATGACAGACGAACAATCACCCGAAGAGTACATCAGCTACAACGGTCTTGGACGTAGCCCAATGATCTGGG
GAATTCCGTACATGGCAGGATTAGCGATCATGTGTTTATCACTGCTTGGCGGTTTATTGCTTGGTACCTT
TGTTGCTAGCTGGGGTTGGCTGTTTTCTCTTATTGGTGTGCCAATGATTTTGTTCGTCAAGATCATTTGC
ACAAATGACGATAAGGCCATTCGGATTCTGATGCTCGAAGTGAAATGGAGCCTTCTTAAAGCGCTCAATG
GCAACGCTAAATATCACGGCGGAACAATGGCGATTGCTCCAACAACTTACGGTCGTAAACTCAAAAATGT
TAAGCGCTATTTTAAAAAAACAGTTTGCGGGTGA
 Primer design