SecReT4
Protein ID: 295788878
T4SS name [ID]VirB [436]
Gene symbolORF19
Locus tagpXFRIV11_p19
StrainXylella fastidiosa plasmid pXF-RIV11 (NC_014111)
Repliconplasmid pXF-RIV11 [GenBank: NC_014111] [Browse all T4SS(s) in this replicon]
Location [Strand]16112..16432 [-]
ProductP19
Component typeVirB2
UniProt IDD5LLB6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.8e-16, Aligned region: 1..100
Protein Sequence: 106 a.a.     [Download]
>gi|295788878|ref|YP_003603474.1| P19 [Xylella fastidiosa]
MKHIFNQLVAKYHHVILAIAISTTSSNALASVGGLGGLTRAKTAAENIKTGLYALVGVIAMIYLIYLGVM
AFTEKKSWADFGWGVVYVSLVGGAVALGGWAWTLFA
 
Nucleotide Sequence: 321 bp     [Download]
>gi|295788859|ref|NC_014111.1|:c16432-16112 Xylella fastidiosa plasmid pXF-RIV11, complete sequence
ATGAAACATATTTTTAACCAATTGGTGGCTAAATATCATCATGTGATTTTGGCTATTGCGATTTCTACTA
CGTCGTCAAATGCTCTCGCGTCAGTTGGAGGATTGGGTGGTCTCACAAGGGCAAAAACAGCCGCTGAGAA
CATAAAAACAGGACTTTATGCCCTGGTTGGTGTCATTGCCATGATTTACCTGATTTATTTGGGTGTGATG
GCATTCACTGAGAAGAAATCATGGGCAGATTTTGGGTGGGGCGTGGTGTACGTCTCATTGGTCGGTGGTG
CGGTGGCGCTTGGTGGCTGGGCCTGGACACTGTTCGCTTGA
 Primer design