SecReT4
Protein ID: 295788903
T4SS name [ID]VirB [435]
Gene symbolORF10
Locus tagpXFRIV16_p10
StrainXylella fastidiosa plasmid pXF-RIV16 (NC_014112)
Repliconplasmid pXF-RIV16 [GenBank: NC_014112] [Browse all T4SS(s) in this replicon]
Location [Strand]9626..10336 [-]
ProductP10
Component typeVirB8
UniProt IDD5LLA7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.7e-60, Aligned region: 24..233
Protein Sequence: 236 a.a.     [Download]
>gi|295788903|ref|YP_003603498.1| P10 [Xylella fastidiosa]
MSTQEQAPALNKLARLPQTFVEAAVDFEKSKIEEIKRSRKIAWIIASVATVICSVSILAFLVALLTRSEP
EPTILQVDKSTGATTVLRSVRDTKDHYDEVVNKYWLAQYVRTCEGYDWFTINDQFNACKLMSDSDVAKEY
SSKVDAPGSPLKVLADKGKIVVGIVSIAFLGDTAQVRFTTEKISASGENLDHSPVRKWIATIAFQFKPGL
MTEQQRLINPLGFKVATYRVDPEVIQ
 
Nucleotide Sequence: 711 bp     [Download]
>gi|295788893|ref|NC_014112.1|:c10336-9626 Xylella fastidiosa plasmid pXF-RIV16, complete sequence
ATGAGTACACAAGAGCAAGCACCTGCGCTCAATAAGCTCGCCCGTCTTCCACAAACTTTTGTGGAAGCAG
CGGTAGATTTCGAGAAATCCAAGATTGAAGAGATCAAACGCTCACGCAAGATAGCCTGGATAATCGCAAG
TGTCGCCACGGTGATTTGCAGCGTGTCTATTCTTGCATTCCTGGTGGCTTTGCTGACGCGCTCTGAACCA
GAGCCGACCATTTTGCAGGTGGATAAGAGTACAGGTGCGACTACTGTTTTGCGTTCCGTACGTGATACCA
AAGACCACTACGATGAAGTAGTCAACAAGTATTGGTTAGCTCAATACGTCCGTACTTGCGAAGGTTACGA
CTGGTTCACGATTAACGATCAATTCAATGCGTGTAAATTGATGTCAGATAGCGATGTAGCCAAAGAGTAT
TCCAGCAAAGTGGATGCCCCAGGCTCACCGCTAAAAGTGCTGGCTGACAAGGGAAAAATAGTGGTTGGAA
TCGTTTCTATTGCCTTTCTCGGTGATACTGCCCAAGTACGGTTCACCACTGAAAAAATCAGTGCCAGCGG
TGAGAATCTCGATCATTCTCCAGTGAGAAAGTGGATTGCCACAATCGCTTTTCAATTCAAACCTGGTTTG
ATGACTGAGCAGCAACGGCTGATCAATCCCCTGGGATTTAAGGTTGCAACTTACCGGGTTGATCCCGAAG
TGATTCAATGA
 Primer design