SecReT4
Protein ID: 295788933
T4SS name [ID]VirB [434]
Gene symbolORF6
Locus tagpXFRIV19_p06
StrainXylella fastidiosa plasmid pXF-RIV19 (NC_014113)
Repliconplasmid pXF-RIV19 [GenBank: NC_014113] [Browse all T4SS(s) in this replicon]
Location [Strand]4255..6531 [-]
ProductP6
Component typeVirD4
UniProt IDD5LLA3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 5.5e-103, Aligned region: 95..552
TraG-D_C [PF12696], Evalue: 1.7e-25, Aligned region: 398..517
PLDc_2 [PF13091], Evalue: 1.4e-17, Aligned region: 613..729
TrwB_AAD_bind [PF10412], Evalue: 4.4e-15, Aligned region: 160..531
Protein Sequence: 758 a.a.     [Download]
>gi|295788933|ref|YP_003603527.1| P6 [Xylella fastidiosa]
MSKKKIAIAVLVLLLLAMVSVLVMLYVSSGLLVKYLNLGDLTPHLSLPLDLAKFGTKKEKGFGIIALVVS
VGLPVMLFGIIAYAALAPKKRELHGSARFATRRELVKSGLLQSDKHDDQYPSILVGKQDKDFLFFRGQQF
MFLAAPTRSGKGVGIVIPNLLHYRDSVVVLDIKGENFEITSGFRAKCGQEVHKFAPDDENFQTACWNPLA
YVRNDPRFRISDLMSITNILYPPSDDVWASTAESLFLGLALYIMETSKLHSSFNVATIKKMRVSLGCLKD
EDTFMAHVKERQPFEPLSEDCITHLRSFAQTSDKLRNSIGISFDQPLGIFSDPMTAKATASNSFDLRDVR
KKRMSIYVMVKPANIDKFGKFLNLFFQQLLVLNMDKLPQDDPSLRYQCLLLLDEFPAMGRIAIIEKASAY
MAGYNMRLLLIFQSKSQIKDRKLYDETGAQTMLTNMALQVAYAPRDDDDAKDYSEMIGYMTEKGLSKSRQ
LGLKSGRSESESDQRRAVLLPQEVKAIGQFKEIISMENMAPALVDKIFWYQEPIFQARANLPHPDVPDQS
DLVNTIEPAPPSPTLDFAGAIEEQALPTGATFEVGFSPKRNALEVVMSFVLGAKTELLVAAYSFTSKEIA
FALTEAKARGIDVRVVVDHAQNTDDQGGYKAVDYLSSQGIPVFRCENYAAMHHKFMVADGLHVQLGSFNY
TSSANLRNAETAVAFRNAPELASLYRTEWLRLSTEPKASVETVMAVDRGLAILKEFGI
 
Nucleotide Sequence: 2277 bp     [Download]
>gi|295788927|ref|NC_014113.1|:c6531-4255 Xylella fastidiosa plasmid pXF-RIV19, complete sequence
ATGAGCAAGAAAAAGATAGCAATCGCCGTATTGGTGTTGCTGTTATTGGCCATGGTATCTGTTCTTGTCA
TGCTCTATGTGAGTTCAGGGCTGTTGGTGAAATATCTGAACCTTGGGGATCTGACGCCGCATCTGTCCTT
GCCTTTGGATCTGGCCAAGTTTGGCACGAAGAAGGAAAAGGGGTTCGGCATTATCGCCCTAGTGGTTAGC
GTTGGCCTGCCTGTCATGCTGTTCGGCATCATTGCTTATGCTGCATTGGCCCCGAAAAAGCGAGAGTTAC
ACGGCTCGGCACGGTTCGCCACGCGGCGAGAACTGGTCAAGAGTGGTTTACTACAATCTGACAAACATGA
TGATCAGTACCCATCCATTCTTGTAGGAAAACAGGACAAGGATTTTTTATTCTTCCGTGGCCAGCAATTC
ATGTTCCTGGCCGCGCCTACACGCTCGGGTAAGGGCGTTGGCATCGTGATTCCCAACCTGCTCCATTACC
GTGACTCGGTGGTCGTGCTGGATATCAAGGGCGAGAACTTCGAAATTACTTCTGGCTTCCGTGCCAAGTG
CGGTCAGGAGGTTCACAAGTTCGCGCCGGATGACGAGAACTTTCAAACCGCCTGCTGGAACCCATTGGCC
TACGTGCGCAATGACCCGCGTTTTCGCATCAGCGACTTAATGAGCATCACCAATATTCTGTATCCGCCCA
GTGATGACGTGTGGGCCTCCACGGCTGAAAGCTTGTTTCTTGGTCTGGCGCTTTACATCATGGAGACATC
TAAGCTGCACAGCAGCTTCAACGTGGCTACGATCAAGAAAATGCGTGTCAGCCTCGGTTGTTTGAAGGAT
GAGGACACCTTCATGGCTCACGTCAAAGAACGTCAGCCTTTTGAACCGCTTTCTGAGGACTGTATTACCC
ACTTACGCAGCTTCGCACAGACTAGCGACAAGTTGCGCAATAGCATTGGGATTTCGTTCGATCAGCCCTT
GGGCATCTTCAGCGACCCGATGACTGCAAAAGCGACGGCCTCCAACAGCTTCGATCTGCGCGACGTGCGC
AAAAAGCGCATGAGTATCTATGTGATGGTGAAGCCTGCAAATATTGACAAGTTCGGTAAGTTTTTGAATC
TTTTTTTTCAGCAGCTTCTTGTACTGAACATGGACAAGCTGCCGCAGGATGACCCCAGCCTGAGGTACCA
ATGCCTGTTGCTGCTTGATGAGTTCCCTGCCATGGGGCGCATCGCCATCATTGAAAAGGCATCGGCGTAC
ATGGCTGGGTACAACATGCGCTTGCTGTTGATTTTCCAAAGCAAAAGCCAGATTAAAGACCGCAAGCTAT
ACGACGAAACCGGCGCTCAAACCATGTTGACCAACATGGCCTTGCAGGTTGCATATGCCCCCCGTGACGA
CGATGATGCAAAGGATTACAGCGAGATGATCGGTTACATGACCGAGAAGGGTTTATCTAAGTCTCGTCAA
CTCGGCCTGAAGTCCGGGCGCAGTGAATCCGAAAGCGATCAACGCCGTGCGGTATTACTTCCCCAAGAAG
TGAAAGCGATCGGCCAGTTCAAAGAGATCATCAGCATGGAGAACATGGCTCCGGCGCTGGTAGACAAAAT
ATTTTGGTATCAAGAACCGATTTTTCAGGCTAGGGCAAACCTGCCACACCCTGATGTTCCTGACCAAAGC
GATCTGGTCAACACAATTGAACCAGCTCCCCCCTCCCCTACTCTGGACTTTGCAGGCGCGATTGAGGAGC
AAGCATTACCCACTGGGGCGACGTTTGAAGTTGGGTTCTCACCCAAGCGTAATGCCCTTGAAGTGGTCAT
GTCGTTCGTACTGGGTGCCAAAACTGAACTCCTGGTAGCCGCATACTCGTTCACCAGCAAGGAAATCGCA
TTTGCCTTGACTGAGGCCAAGGCACGCGGCATTGATGTTCGCGTGGTGGTTGATCACGCGCAAAACACAG
ACGATCAGGGGGGCTATAAGGCCGTCGATTATCTGTCGTCACAAGGTATCCCTGTTTTTAGGTGCGAGAA
CTATGCGGCGATGCACCACAAGTTCATGGTGGCTGATGGTCTGCATGTACAACTCGGGAGCTTTAACTAC
ACATCTTCGGCAAACCTACGCAACGCCGAAACGGCGGTAGCATTCCGCAACGCCCCTGAGCTGGCCAGCT
TGTATAGGACGGAATGGCTGCGCCTGTCCACTGAACCCAAGGCATCGGTTGAAACGGTCATGGCCGTTGA
TCGTGGCTTGGCCATCCTCAAGGAATTTGGAATTTAA
 Primer design