SecReT4
Protein ID: 295788934
T4SS name [ID]VirB [434]
Gene symbolORF7
Locus tagpXFRIV19_p07
StrainXylella fastidiosa plasmid pXF-RIV19 (NC_014113)
Repliconplasmid pXF-RIV19 [GenBank: NC_014113] [Browse all T4SS(s) in this replicon]
Location [Strand]6528..7571 [-]
ProductP7
Component typeVirB11
UniProt IDD5LLA4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 8.3e-58, Aligned region: 33..323
Protein Sequence: 347 a.a.     [Download]
>gi|295788934|ref|YP_003603528.1| P7 [Xylella fastidiosa]
MSLTLLNDAPQKPVSQVDRSLSVRELMRKYGISEALMANITEFAINRPGSYWVEDAAGWREVTNESLSLS
HLQGLATATAVFNQKKLDRDNPIASLTLPDGERCQVVLPPACENGTVSMTIRKPSSSRFSLADYANSGRL
KPVLAGLSDEIQPWEAELLQLVQRGDFVRFFELAVEHRLNIVTVGGTGSGKTTFSKCLIDLYPTSCRLFT
IEDAHELTTPKHPNSVHLFFSPAITAKAVLSSCMRMKPDHIFITELRGDETWDYLMALKSGHSGSVTSIH
ANDCRGALYKIGSYIKQSEVGQTLDFNYIMQEVMTTIDVVVFFEKTHLKELYFDPVKKLQLLRGGAS
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|295788927|ref|NC_014113.1|:c7571-6528 Xylella fastidiosa plasmid pXF-RIV19, complete sequence
ATGTCTTTAACCTTGTTGAATGATGCCCCACAAAAACCGGTAAGCCAGGTTGACCGATCCCTGTCTGTGC
GGGAGCTGATGCGGAAATACGGTATCTCCGAAGCATTGATGGCGAACATCACAGAGTTTGCGATCAACAG
GCCAGGCAGTTACTGGGTTGAGGACGCTGCGGGTTGGCGTGAGGTGACTAATGAGTCACTGTCGCTCTCT
CACCTTCAAGGGTTGGCCACGGCTACAGCCGTGTTCAACCAGAAGAAGCTCGACCGCGACAACCCGATTG
CCTCGCTCACACTCCCTGATGGGGAACGCTGCCAAGTTGTGCTGCCTCCTGCCTGCGAAAATGGCACGGT
CAGCATGACGATTCGCAAGCCTTCAAGCAGTCGTTTTTCACTGGCCGACTATGCGAATTCCGGAAGACTC
AAACCTGTTTTGGCGGGCCTGTCTGATGAGATTCAGCCTTGGGAAGCTGAATTGCTTCAACTGGTTCAAA
GGGGCGATTTCGTGCGCTTTTTTGAGCTAGCGGTAGAACATCGCTTGAACATCGTGACAGTTGGCGGCAC
AGGGTCAGGGAAAACGACGTTCTCAAAGTGTCTGATTGATTTATATCCGACCTCATGCCGTCTTTTCACG
ATTGAGGATGCTCACGAGTTAACTACACCCAAGCATCCTAACTCGGTACACCTTTTTTTCAGTCCAGCCA
TCACCGCCAAAGCAGTGTTATCGAGCTGCATGCGTATGAAACCAGATCATATTTTTATCACCGAGCTACG
GGGTGATGAAACATGGGATTACCTGATGGCCTTGAAATCAGGCCATAGCGGCTCCGTCACTTCCATCCAC
GCCAACGATTGCCGTGGCGCTCTTTACAAAATTGGCTCTTACATCAAGCAATCAGAAGTCGGCCAAACGT
TGGATTTTAACTACATCATGCAAGAGGTCATGACGACCATTGATGTGGTTGTTTTCTTCGAAAAAACCCA
CCTGAAAGAACTGTACTTTGACCCCGTGAAAAAACTTCAACTATTGCGGGGCGGTGCGTCATGA
 Primer design