SecReT4
Protein ID: 295788937
T4SS name [ID]VirB [434]
Gene symbolORF10
Locus tagpXFRIV19_p10
StrainXylella fastidiosa plasmid pXF-RIV19 (NC_014113)
Repliconplasmid pXF-RIV19 [GenBank: NC_014113] [Browse all T4SS(s) in this replicon]
Location [Strand]9626..10336 [-]
ProductP10
Component typeVirB8
UniProt IDD5LLH3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4.5e-61, Aligned region: 24..233
Protein Sequence: 236 a.a.     [Download]
>gi|295788937|ref|YP_003603531.1| P10 [Xylella fastidiosa]
MSTQEQAPALNKLARLPQTFVEAAVDFEKSKIEEIKRSRKIAWIIASVATVICSVSILAFLVALLTRSEP
EPTILQVDKSTGATTVLRSVRDTKDHYDEVVNKYWLAQYVRTCEGYDWFTINDQFNACKLMSDSDVAKEY
SSKVDAPGSPLKVLADKGKIVVGIVSIAFLGDTAQVRFTTEKLSASGENLDHSPVRKWIATIAFQFKPGL
MTEQQRLINPLGFKVATYRVDPEVIQ
 
Nucleotide Sequence: 711 bp     [Download]
>gi|295788927|ref|NC_014113.1|:c10336-9626 Xylella fastidiosa plasmid pXF-RIV19, complete sequence
ATGAGTACACAAGAGCAAGCACCTGCGCTCAATAAGCTCGCCCGTCTTCCACAAACTTTTGTGGAAGCAG
CGGTAGATTTCGAGAAATCCAAGATTGAAGAGATCAAACGCTCACGCAAGATAGCCTGGATAATCGCAAG
TGTCGCCACGGTGATTTGCAGCGTGTCTATTCTTGCATTCCTGGTGGCTTTGCTGACGCGCTCTGAACCA
GAGCCGACCATTTTGCAGGTGGATAAGAGTACAGGTGCGACTACTGTTTTGCGTTCCGTACGTGATACCA
AAGACCACTACGATGAAGTAGTCAACAAGTATTGGTTAGCTCAATACGTCCGTACTTGCGAAGGTTACGA
CTGGTTCACGATTAACGATCAATTCAATGCGTGTAAATTGATGTCAGATAGCGATGTAGCCAAAGAGTAT
TCCAGCAAAGTGGATGCCCCAGGCTCACCGCTAAAAGTGCTGGCTGACAAGGGAAAAATAGTGGTTGGAA
TCGTTTCTATTGCCTTTCTCGGTGATACTGCCCAAGTACGGTTCACCACTGAAAAACTCAGTGCCAGCGG
TGAGAATCTCGATCATTCTCCAGTGAGAAAGTGGATTGCCACAATCGCTTTTCAATTCAAACCTGGTTTG
ATGACTGAGCAGCAACGGCTGATCAATCCCCTGGGATTTAAGGTTGCAACTTACCGGGTTGATCCCGAAG
TGATTCAATGA
 Primer design