SecReT4
Protein ID: 295791906
T4SS name [ID]VirB [433]
Gene symbolORF7
Locus tagpXFRIV25_p07
StrainXylella fastidiosa plasmid pXF-RIV25 (NC_014114)
Repliconplasmid pXF-RIV25 [GenBank: NC_014114] [Browse all T4SS(s) in this replicon]
Location [Strand]6528..7571 [-]
ProductP7
Component typeVirB11
UniProt IDD5LLA4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 8.3e-58, Aligned region: 33..323
Protein Sequence: 347 a.a.     [Download]
>gi|295791906|ref|YP_003603558.1| P7 [Xylella fastidiosa]
MSLTLLNDAPQKPVSQVDRSLSVRELMRKYGISEALMANITEFAINRPGSYWVEDAAGWREVTNESLSLS
HLQGLATATAVFNQKKLDRDNPIASLTLPDGERCQVVLPPACENGTVSMTIRKPSSSRFSLADYANSGRL
KPVLAGLSDEIQPWEAELLQLVQRGDFVRFFELAVEHRLNIVTVGGTGSGKTTFSKCLIDLYPTSCRLFT
IEDAHELTTPKHPNSVHLFFSPAITAKAVLSSCMRMKPDHIFITELRGDETWDYLMALKSGHSGSVTSIH
ANDCRGALYKIGSYIKQSEVGQTLDFNYIMQEVMTTIDVVVFFEKTHLKELYFDPVKKLQLLRGGAS
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|295791899|ref|NC_014114.1|:c7571-6528 Xylella fastidiosa plasmid pXF-RIV25, complete sequence
ATGTCTTTAACCTTGTTGAATGATGCCCCACAAAAACCGGTAAGCCAGGTTGACCGATCCCTGTCTGTGC
GGGAGCTGATGCGGAAATACGGTATCTCCGAAGCATTGATGGCGAACATCACAGAGTTTGCGATCAACAG
GCCAGGCAGTTACTGGGTTGAGGACGCTGCGGGTTGGCGTGAGGTGACTAATGAGTCACTGTCGCTCTCT
CACCTTCAAGGGTTGGCCACGGCTACAGCCGTGTTCAACCAGAAGAAGCTCGACCGCGACAACCCGATTG
CCTCGCTCACACTCCCTGATGGGGAACGCTGCCAAGTTGTGCTGCCTCCTGCCTGCGAAAATGGCACGGT
CAGCATGACGATTCGCAAGCCTTCAAGCAGTCGTTTTTCACTGGCCGACTATGCGAATTCCGGAAGACTC
AAACCTGTTTTGGCGGGCCTGTCTGATGAGATTCAGCCTTGGGAAGCTGAATTGCTTCAACTGGTTCAAA
GGGGCGATTTCGTGCGCTTTTTTGAGCTAGCGGTAGAACATCGCTTGAACATCGTGACAGTTGGCGGCAC
AGGGTCAGGGAAAACGACGTTCTCAAAGTGTCTGATTGATTTATATCCGACCTCATGCCGTCTTTTCACG
ATTGAGGATGCTCACGAGTTAACTACACCCAAGCATCCTAACTCGGTACACCTTTTTTTCAGTCCAGCCA
TCACCGCCAAAGCAGTGTTATCGAGCTGCATGCGTATGAAACCAGATCATATTTTTATCACCGAGCTACG
GGGTGATGAAACATGGGATTACCTGATGGCCTTGAAATCAGGCCATAGCGGCTCCGTCACTTCCATCCAC
GCCAACGATTGCCGTGGCGCTCTTTACAAAATTGGCTCTTACATCAAGCAATCAGAAGTCGGCCAAACGT
TGGATTTTAACTACATCATGCAAGAGGTCATGACGACCATTGATGTGGTTGTTTTCTTCGAAAAAACCCA
CCTGAAAGAACTGTACTTTGACCCCGTGAAAAAACTTCAACTATTGCGGGGCGGTGCGTCATGA
 Primer design