SecReT4
Protein ID: 295791914
T4SS name [ID]VirB [433]
Gene symbolORF18
Locus tagpXFRIV25_p15
StrainXylella fastidiosa plasmid pXF-RIV25 (NC_014114)
Repliconplasmid pXF-RIV25 [GenBank: NC_014114] [Browse all T4SS(s) in this replicon]
Location [Strand]14992..15375 [-]
ProductP18
Component typeVirB3
UniProt IDD5LLB5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 127 a.a.     [Download]
>gi|295791914|ref|YP_003603566.1| P18 [Xylella fastidiosa]
MTDEQSPEEYISYNGLGRSPMIWGIPYMAGLAIMCLSLLGGLLLGTFVASWGWLFSLIGVPMILFVKIIC
TNDDKAIRILMLEVKWSLLKALNGNAKYHGGTMAIAPTTYGRKLKNVKRYFKKTVCG
 
Nucleotide Sequence: 384 bp     [Download]
>gi|295791899|ref|NC_014114.1|:c15375-14992 Xylella fastidiosa plasmid pXF-RIV25, complete sequence
ATGACAGACGAACAATCACCCGAAGAGTACATCAGCTACAACGGTCTTGGACGTAGCCCAATGATCTGGG
GAATTCCGTACATGGCAGGATTAGCGATCATGTGTTTATCACTGCTTGGCGGTTTATTGCTTGGTACCTT
TGTTGCTAGCTGGGGTTGGCTGTTTTCTCTTATTGGTGTGCCAATGATTTTGTTCGTCAAGATCATTTGC
ACAAATGACGATAAGGCCATTCGGATTCTGATGCTCGAAGTGAAATGGAGCCTTCTTAAAGCGCTCAATG
GCAACGCTAAATATCACGGCGGAACAATGGCGATTGCTCCAACAACTTACGGTCGTAAACTCAAAAATGT
TAAGCGCTATTTTAAAAAAACAGTTTGCGGGTGA
 Primer design