SecReT4
Protein ID: 296100198
T4SS name [ID]Tra_F [579]
Gene symboltrhN
Locus tagpDK1_p030
StrainPseudomonas putida plasmid pDK1 (NC_014124)
Repliconplasmid pDK1 [GenBank: NC_014124] [Browse all T4SS(s) in this replicon]
Location [Strand]21381..24017 [+]
Productmating pair stabilization protein
Component typeTraN_F
UniProt IDD5MP97
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 9.9e-52, Aligned region: 374..612
TraN [PF06986], Evalue: 9.9e-52, Aligned region: 722..798
Protein Sequence: 878 a.a.     [Download]
>gi|296100198|ref|YP_003617115.1| mating pair stabilization protein [Pseudomonas putida]
MDMRSMRQPLKTTLRRLVNVTVIGLYLNSMTFTAWADAVTAGSAAGQSVGQQALQVFDGGDASVTLQDLF
PETGDTASLENVYGDDVKTIDLGLRANTRLQSESSSEGEAYRTLIDSGNRMSVDLSNDPMLNQADQVRSP
DFMDGFKQNFADCTSTEVFENVTKNAHVANYKTCERVVDQGGNVEFLHDYKVGVIEYVSGQPNFQSCGPG
CLYIWVGTVGDNYWSGNCKIYEEYTRFRVIAKDAIISATVDRAVFDDYFQILFNDEMLWTHTPGVFPPET
AGSCERGTSWNVAPNKVITDKFGSDDDVITFKTRTSVTGGGEGYARIKIIYDPAKAFVDNGWGPEERLPM
FDMIEDGFCTNAQMSCTSMPAVDANGCTETNGVRICRSDMPPSPHPSIDPLCKKAQVSAECSYYKGNMDC
YTDAQGVQRCPSNDGGNLNTCTQYEQNPSCGFISQGCIDGAKGETGSCYAFEEVWDCGYDTSYETIVNTG
AQIECPGGARCMGSECFDSSNTKSGDFAYAVAMLQVAQFAEHDLDCGGDGTDINEANDCKVFKGEAMECK
KALGGYVDCCEAPESVSIFDYVNLTMNTLKMTSSLEALSRTGNLFAPGYWAAGTEAAMSVGSSVIKGQWG
TIVDSATAAFNEGFQGAAMGQIQQWLMQQAYDAMVEMGASAAANAVFATGAEGTATQGTVTGLSANAAMV
VNIIGWVYMVYVIVDLLINIIWECEQKEFELGAKKETRQCHFVGSYCASEALGSCVEKREAYCCFGSVVA
RIIQESAREQLGLGWGDVKSPTCEGITPAQMAQMDWSRVDLSEWIGMLNLAGRLPTANTVSLEDITGSGS
KLQTTDGEKRLNTLDRNLQRLENFDVDAVKRKAEEGLR
 
Nucleotide Sequence: 2637 bp     [Download]
>gi|296100168|ref|NC_014124.1|:21381-24017 Pseudomonas putida plasmid pDK1, complete sequence
TTGGACATGCGATCGATGCGACAACCACTCAAAACAACGCTGAGACGGCTGGTCAACGTGACCGTGATCG
GCCTGTATCTCAACAGCATGACCTTCACAGCCTGGGCCGACGCTGTGACAGCAGGATCTGCGGCCGGTCA
ATCGGTAGGCCAGCAGGCACTTCAGGTATTCGATGGTGGGGACGCCTCCGTCACGCTTCAGGATCTTTTC
CCTGAAACTGGAGACACTGCCTCGCTCGAGAACGTCTACGGCGACGATGTGAAGACGATCGATCTCGGGT
TGCGAGCAAATACCCGCCTCCAATCGGAATCGTCCTCTGAGGGAGAGGCATACCGAACCCTGATCGACAG
CGGCAACCGCATGTCGGTAGATCTCTCCAACGACCCTATGCTCAATCAGGCTGATCAAGTTCGTTCCCCT
GACTTCATGGATGGGTTTAAGCAGAACTTCGCGGACTGCACCTCTACCGAAGTTTTTGAGAACGTGACGA
AAAACGCCCATGTTGCCAATTACAAAACATGTGAGCGCGTCGTGGATCAAGGCGGAAACGTTGAGTTCCT
GCATGACTACAAGGTAGGTGTAATCGAATACGTTTCCGGGCAGCCAAACTTTCAGTCGTGCGGACCAGGT
TGCTTGTACATCTGGGTCGGCACGGTAGGGGACAACTACTGGAGCGGGAACTGCAAAATCTATGAGGAGT
ACACCCGATTCCGCGTGATAGCCAAGGACGCCATTATTTCAGCTACCGTCGACAGAGCTGTTTTCGACGA
TTATTTCCAAATCCTTTTCAATGACGAAATGCTTTGGACGCACACACCTGGTGTCTTCCCGCCGGAAACA
GCTGGAAGCTGCGAACGCGGAACAAGCTGGAACGTAGCTCCGAACAAGGTGATCACTGACAAGTTCGGCA
GCGATGATGACGTGATCACGTTCAAAACCCGCACCTCGGTTACCGGTGGTGGTGAGGGTTACGCCCGCAT
CAAGATCATCTATGACCCGGCAAAGGCGTTTGTCGATAATGGTTGGGGGCCGGAAGAGCGCCTGCCTATG
TTCGACATGATCGAGGATGGGTTCTGCACCAACGCTCAGATGTCGTGCACGTCTATGCCGGCGGTGGACG
CCAATGGCTGTACTGAAACCAATGGCGTTCGGATCTGCCGCTCTGACATGCCACCATCCCCGCACCCGAG
CATCGATCCGCTTTGCAAGAAGGCCCAGGTAAGCGCCGAGTGCTCCTACTACAAGGGGAATATGGATTGC
TACACGGACGCCCAGGGTGTGCAGCGGTGCCCCTCAAATGATGGCGGCAACCTGAATACCTGCACCCAGT
ACGAGCAGAACCCCAGCTGCGGTTTTATCTCTCAAGGTTGTATTGATGGCGCAAAAGGCGAGACAGGCTC
TTGCTATGCCTTCGAGGAGGTCTGGGACTGCGGTTATGACACCAGCTACGAAACTATCGTGAACACTGGG
GCCCAAATCGAATGCCCTGGTGGGGCGCGCTGCATGGGCAGTGAGTGTTTCGACTCGTCGAACACGAAAA
GCGGCGATTTTGCCTATGCGGTGGCCATGCTTCAGGTTGCTCAGTTTGCTGAGCACGACCTGGACTGCGG
TGGTGATGGTACCGATATCAACGAGGCCAATGACTGCAAGGTGTTCAAAGGCGAGGCTATGGAGTGCAAG
AAGGCGCTCGGGGGCTATGTTGACTGCTGCGAAGCGCCGGAAAGCGTAAGCATCTTCGACTATGTAAACC
TGACCATGAACACTCTCAAGATGACCAGCTCACTTGAGGCATTGAGCAGGACAGGAAATCTCTTTGCGCC
GGGATACTGGGCCGCGGGCACTGAAGCTGCCATGTCTGTCGGCTCCTCGGTTATCAAGGGCCAGTGGGGC
ACCATTGTCGATAGCGCCACTGCTGCGTTCAATGAGGGATTCCAAGGTGCAGCGATGGGACAGATTCAGC
AATGGCTGATGCAGCAGGCCTATGATGCAATGGTTGAAATGGGGGCCTCTGCTGCTGCAAATGCGGTATT
CGCTACAGGTGCAGAAGGCACCGCGACCCAGGGTACTGTTACTGGACTAAGCGCCAACGCTGCGATGGTA
GTTAATATCATCGGCTGGGTTTATATGGTCTATGTGATTGTGGATCTGCTGATCAACATTATTTGGGAGT
GCGAGCAGAAGGAGTTCGAGCTTGGTGCGAAAAAGGAAACCCGGCAATGCCACTTTGTTGGCAGCTACTG
CGCATCCGAAGCACTTGGGTCATGCGTTGAAAAGCGAGAGGCCTATTGCTGCTTTGGCTCGGTTGTAGCG
CGCATCATTCAAGAGTCAGCCCGTGAACAACTGGGGTTGGGATGGGGTGACGTAAAGTCGCCTACGTGCG
AAGGAATTACGCCAGCTCAGATGGCGCAGATGGATTGGTCGCGTGTGGATCTGTCTGAGTGGATCGGCAT
GCTGAATCTTGCAGGGCGTCTTCCTACCGCTAATACAGTTTCCCTGGAGGATATTACCGGGAGTGGTAGT
AAACTTCAGACAACAGATGGAGAAAAGCGTCTGAACACATTAGATAGAAACCTACAGAGGCTTGAGAATT
TCGATGTAGACGCGGTAAAGAGAAAGGCAGAGGAAGGGCTGCGATAA
 Primer design