SecReT4
Protein ID: 296100210
T4SS name [ID]Tra_F [579]
Gene symboltraI
Locus tagpDK1_p042
StrainPseudomonas putida plasmid pDK1 (NC_014124)
Repliconplasmid pDK1 [GenBank: NC_014124] [Browse all T4SS(s) in this replicon]
Location [Strand]33731..36283 [+]
Productrelaxase
Component typeTraI_F
UniProt IDD5MPA9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraI_2 [PF07514], Evalue: 7.3e-107, Aligned region: 59..379
Protein Sequence: 850 a.a.     [Download]
>gi|296100210|ref|YP_003617127.1| relaxase [Pseudomonas putida]
MAEKRMPPFSFLKRLWPRSERALTDSFAHPAEQMITPEIKRYLENHNWRNLRYPPYQEGYPGLVSGQWFM
RNYQHELFDRIIHSVGMPASDLKLYVEPILVNFAELAHMLPASENHHHSGPGGLLRHSLEVASLTLDGCL
TTAFDTNETPARRSMRLRRWYVAGIASGLLHDAGKPLTDIRATDFEGNNQWIYAQETLHDWSVRNKLTRY
FLHWNSNRHGNHVQVSVAQATRIIPPAVQAWLIEGGHDIYEALLDAISGSGSSPLTELVKWADSASTKRD
LNRGSNNGGGNATGVPVPRLVSDAMLRLLSDGTWKINTPAGRVWVATDGVYIAWNQGAEEIVSMLVGDGV
VAIPRSPDTLIGTLVEHGIAERAPNGDLYWLVTPHLLRKNGKGPALRCMKLVNPDILFPTTPIPPPVSIS
LGKEGKQKDVIAPNDTAGAAANALSEHQEDLFGADLTGDSSGDTDADSEPTPPKESASSKPARKKKAAPR
QAAPVPTTASSGVSLKQAQNPAEDAPVGVESEPAGDDTAVIASSQPEEALDAEEEEEAPQEPPASLEEML
LFLSPHSPAAEPQQEEPLPAAEAEISSDPSDADTQAGSGQGAQELLPRQEKISLNSIMGQGKRTPKTTPP
VESKKQKDGEVGRVAEEVPGVSSILPAGVVSKLTAHECYLLEQQPDLAQKLITATQDPENAALARNKVFV
RLGKSSFLAEDIHPLVHAGWLWQDITVEGPALTRTLQSREGFMLTSDYSVIYCKLAELDWVIPHISRLRE
ADIPSLEQAVKSLIEKAVLEEIGGSPVLSLTTYMLTNVAEQFGITPTSLENAVFCFRDAVKVAKRRKIFV
RPLYEELPKK
 
Nucleotide Sequence: 2553 bp     [Download]
>gi|296100168|ref|NC_014124.1|:33731-36283 Pseudomonas putida plasmid pDK1, complete sequence
ATGGCCGAGAAGCGTATGCCTCCATTTTCATTCCTGAAACGCCTGTGGCCTCGAAGCGAGCGTGCCCTTA
CGGACAGCTTCGCGCACCCGGCCGAGCAGATGATTACTCCTGAAATCAAGCGGTACCTGGAGAACCATAA
CTGGCGAAACCTTCGGTACCCACCTTACCAAGAGGGTTATCCAGGGCTGGTTAGCGGGCAGTGGTTCATG
CGCAATTATCAGCACGAGCTGTTCGATCGGATTATTCATTCAGTCGGAATGCCTGCCAGTGACCTCAAGC
TCTACGTTGAGCCGATCCTGGTGAATTTCGCCGAATTGGCGCACATGCTGCCGGCGTCGGAGAACCACCA
TCACTCCGGCCCAGGGGGGTTGCTCCGACATAGCCTTGAGGTCGCCTCGCTCACCCTGGATGGGTGCCTT
ACGACAGCCTTTGATACAAACGAGACCCCGGCACGGCGAAGCATGCGCCTGCGTCGGTGGTACGTCGCGG
GCATCGCGTCAGGGCTGCTACACGACGCAGGGAAGCCTCTCACGGATATTCGCGCCACCGATTTTGAAGG
CAACAACCAGTGGATCTACGCGCAGGAAACGCTTCATGACTGGTCTGTGCGCAACAAGTTGACCCGCTAT
TTCCTGCATTGGAATTCCAATAGGCATGGGAATCACGTTCAGGTCTCTGTAGCGCAAGCAACACGGATCA
TTCCGCCAGCCGTACAGGCGTGGCTGATTGAAGGTGGCCACGACATCTATGAAGCGCTCCTCGATGCAAT
TTCCGGGAGCGGAAGCTCGCCTCTGACCGAGTTGGTCAAGTGGGCCGACTCTGCATCCACCAAGCGTGAC
CTCAATCGAGGCTCGAATAATGGCGGGGGCAATGCAACAGGTGTCCCGGTACCGCGGTTGGTGTCGGATG
CAATGCTGCGGTTGCTGAGTGACGGAACCTGGAAGATCAACACGCCTGCCGGCCGCGTATGGGTTGCAAC
TGATGGCGTCTACATCGCTTGGAACCAGGGTGCCGAGGAGATTGTGAGCATGCTGGTCGGTGATGGGGTT
GTGGCCATCCCGCGATCACCTGACACGCTAATTGGTACCTTGGTAGAGCACGGGATAGCAGAGAGAGCCC
CAAACGGCGACCTGTACTGGCTGGTTACGCCTCACCTTCTGCGCAAGAACGGCAAAGGCCCGGCGCTGCG
CTGCATGAAGCTTGTGAATCCGGACATCCTTTTTCCAACCACACCGATTCCGCCGCCAGTTTCCATCAGC
CTTGGGAAGGAGGGAAAGCAGAAGGATGTCATTGCTCCTAACGATACGGCTGGCGCAGCAGCGAACGCGC
TGAGTGAGCATCAGGAAGACCTGTTTGGGGCTGATCTGACTGGGGACTCGAGCGGGGATACTGACGCTGA
TTCGGAGCCTACACCTCCAAAAGAATCCGCATCGTCGAAACCAGCAAGAAAGAAAAAAGCGGCTCCAAGG
CAAGCAGCTCCGGTACCAACAACCGCCTCTTCAGGGGTTAGCCTCAAACAAGCGCAGAACCCCGCCGAAG
ACGCCCCTGTGGGTGTGGAGTCAGAGCCGGCAGGTGACGATACGGCTGTAATTGCTTCCTCTCAACCAGA
GGAAGCTTTGGATGCTGAGGAGGAAGAAGAAGCACCTCAGGAGCCTCCTGCCAGCCTTGAGGAAATGCTG
CTTTTCTTGAGTCCTCACTCGCCGGCGGCTGAGCCCCAGCAAGAAGAACCACTCCCGGCCGCTGAGGCTG
AAATTAGCTCCGATCCCTCTGATGCTGATACGCAGGCTGGATCAGGGCAGGGGGCGCAGGAGCTGTTACC
TCGTCAGGAAAAGATCTCCCTCAACTCCATCATGGGGCAAGGCAAACGCACGCCTAAAACTACGCCTCCG
GTGGAATCGAAGAAGCAGAAAGACGGAGAGGTCGGCCGCGTGGCGGAGGAGGTGCCAGGCGTTTCCAGCA
TCTTGCCAGCCGGTGTCGTCTCGAAGCTTACAGCGCACGAATGCTACCTGCTGGAACAACAACCTGATCT
TGCCCAAAAGCTCATCACCGCTACTCAAGACCCCGAGAACGCGGCATTAGCGAGAAACAAGGTATTCGTT
CGACTGGGGAAATCCTCCTTCCTTGCTGAGGACATCCACCCGCTCGTCCATGCGGGCTGGCTGTGGCAGG
ACATTACCGTCGAGGGGCCAGCCCTGACCCGAACCCTACAGTCCCGTGAAGGCTTCATGCTCACGTCCGA
CTACAGCGTTATTTACTGCAAGTTAGCGGAGCTGGACTGGGTTATTCCTCACATATCCCGGCTTCGCGAG
GCCGACATCCCAAGCCTCGAGCAGGCTGTGAAGTCGCTGATCGAGAAGGCCGTACTTGAGGAAATAGGCG
GATCACCTGTGCTCAGCCTCACAACCTACATGCTCACGAATGTCGCTGAGCAGTTCGGCATCACGCCAAC
ATCTCTAGAGAACGCGGTGTTCTGCTTCCGCGATGCCGTCAAGGTCGCCAAGCGCAGAAAAATCTTCGTT
CGCCCCCTTTACGAGGAGCTTCCCAAAAAATGA
 Primer design