SecReT4
Protein ID: 296100211
T4SS name [ID]Tra_F [579]
Gene symboltraG
Locus tagpDK1_p043
StrainPseudomonas putida plasmid pDK1 (NC_014124)
Repliconplasmid pDK1 [GenBank: NC_014124] [Browse all T4SS(s) in this replicon]
Location [Strand]36280..38109 [+]
Productcoupling protein
Component typeTraD_F
UniProt IDD5MPB0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 4.9e-18, Aligned region: 161..533
TrwB_AAD_bind [PF10412], Evalue: 1.2e-15, Aligned region: 156..197
TrwB_AAD_bind [PF10412], Evalue: 1.2e-15, Aligned region: 443..564
TraG-D_C [PF12696], Evalue: 2.6e-14, Aligned region: 456..566
Protein Sequence: 609 a.a.     [Download]
>gi|296100211|ref|YP_003617128.1| coupling protein [Pseudomonas putida]
MSEWDYTSYWRKNYEAREAVAWGSSMLAGTAVQLMTEMPVTPYLITLGVQAGFALAAIPRALRVHRAKAC
LVGADLSFITLEEVMELVKRHPHEFYFGEAFPWRQRHGQYAFELQAMDIEAIIGKRGRRNAEVKGTKWIH
GIGMDEEEPCFRPADQRSIHHLVLGTTGAGKTRWFDLAISQCIARGEPVIVIDPKGDKGLAETCERTCKA
MGKASLFKYFHPAHPDKSVRLSLTKNYGRATEVASRVAVLMKSEAGDPFQAFAQMSLNSVIQAMLICNIL
PTLVGLRRTLEGDVPGLTIKVVMAFGSKVFGEDEFARMAESAILSAKVRNIEEKAKVLRKVYYNDIAKVE
ANTDLEGLLTMLEHERSHFSKMIAGLLPILVMLTSGEMGPLLSPHIDDEDPRRISDLNSVINADQVLYLG
LDSLADPMVGSTIGSLALADLASTAGEIYNHRLPKPVNIFVDEAAEVINDQLIQLLNKGRGAGINLYIAT
QTIADFKARMGDEAKAMQVLGNANNIICLRILDTDTQEFVAKKMTPTRYKYVMRTQGNSAGEGGVVQGGN
VGERLMQEEGERFPTALLGELPDLEYLAVFAGGDIRKGRLPILTGPTAN
 
Nucleotide Sequence: 1830 bp     [Download]
>gi|296100168|ref|NC_014124.1|:36280-38109 Pseudomonas putida plasmid pDK1, complete sequence
ATGAGTGAATGGGACTACACCAGTTACTGGCGGAAAAACTACGAGGCGCGGGAAGCAGTTGCGTGGGGTT
CGTCCATGCTCGCCGGCACCGCCGTTCAATTGATGACGGAGATGCCGGTAACCCCATACCTGATAACGCT
TGGCGTGCAGGCTGGATTTGCGTTAGCGGCCATACCAAGGGCCCTCCGCGTTCATCGGGCAAAAGCCTGT
CTCGTTGGAGCAGATCTCTCCTTCATCACCTTGGAGGAGGTGATGGAGCTGGTGAAGAGACACCCACACG
AGTTCTATTTCGGCGAGGCTTTCCCTTGGCGACAGCGGCACGGGCAGTACGCATTCGAGCTCCAGGCGAT
GGATATTGAGGCCATTATCGGTAAGCGTGGCCGCCGCAACGCTGAGGTTAAGGGTACGAAATGGATACAC
GGGATCGGCATGGATGAAGAGGAGCCATGTTTCCGGCCAGCAGACCAGCGTTCGATCCACCACCTCGTGC
TGGGCACAACAGGGGCCGGTAAGACCCGCTGGTTCGACCTGGCCATATCTCAGTGCATCGCTCGTGGTGA
GCCCGTGATCGTAATCGATCCGAAAGGCGATAAAGGCCTAGCCGAAACATGCGAGCGCACATGCAAGGCG
ATGGGGAAGGCCAGCCTGTTCAAATACTTCCACCCTGCACATCCGGATAAGTCGGTTCGTTTGTCGCTGA
CAAAGAACTACGGCCGGGCAACGGAAGTTGCATCCCGTGTGGCAGTGTTGATGAAAAGCGAAGCTGGCGA
TCCATTCCAAGCCTTTGCTCAAATGTCCTTGAATAGCGTGATTCAGGCCATGTTGATCTGCAACATCCTG
CCCACGCTTGTTGGTCTCAGGAGAACCCTTGAGGGAGATGTTCCAGGGCTAACCATCAAGGTGGTTATGG
CCTTCGGTTCAAAGGTCTTCGGTGAAGATGAATTCGCGAGGATGGCCGAATCAGCAATTCTTTCGGCCAA
GGTTCGGAACATCGAAGAGAAGGCGAAGGTATTACGGAAGGTCTATTACAACGATATCGCGAAGGTTGAG
GCCAATACCGATCTGGAAGGCCTGCTCACCATGCTCGAGCACGAGCGATCGCACTTCAGCAAGATGATCG
CTGGCCTTCTTCCAATCCTGGTGATGCTCACCTCCGGTGAAATGGGGCCGCTGCTTTCCCCGCACATCGA
CGACGAAGACCCGCGCCGAATCAGTGACCTCAACTCGGTCATCAATGCCGACCAGGTTCTTTACCTGGGC
CTCGACTCGCTTGCCGACCCGATGGTGGGCTCAACCATCGGGTCGCTGGCCCTGGCCGATCTAGCGTCGA
CAGCGGGCGAGATCTACAACCACAGGTTGCCTAAGCCGGTGAACATCTTTGTCGACGAGGCCGCCGAGGT
GATCAATGACCAGCTCATCCAGCTGCTGAACAAGGGCCGCGGCGCAGGGATAAACCTCTACATCGCAACC
CAGACCATCGCCGACTTCAAGGCCCGCATGGGTGACGAAGCCAAGGCCATGCAGGTTTTGGGGAACGCGA
ACAACATCATCTGCCTCCGCATCCTTGATACCGATACGCAGGAGTTCGTGGCGAAAAAGATGACGCCAAC
TCGCTACAAATACGTGATGCGTACTCAGGGCAACTCGGCAGGTGAAGGCGGGGTGGTGCAGGGCGGGAAT
GTTGGTGAGCGCCTTATGCAAGAGGAGGGTGAGCGCTTCCCAACAGCGCTCCTCGGCGAGCTACCAGACC
TCGAATATCTCGCGGTGTTTGCGGGCGGTGATATCCGCAAGGGGCGACTACCCATTCTTACCGGCCCGAC
TGCCAACTGA
 Primer design