SecReT4
Protein ID: 296100215
T4SS name [ID]Tra_F [579]
Gene symboltrhL
Locus tagpDK1_p047
StrainPseudomonas putida plasmid pDK1 (NC_014124)
Repliconplasmid pDK1 [GenBank: NC_014124] [Browse all T4SS(s) in this replicon]
Location [Strand]39975..40262 [+]
Productsex pilus assembly protein
Component typeTraL_F
UniProt IDD5MPB4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 7.5e-18, Aligned region: 4..95
Protein Sequence: 95 a.a.     [Download]
>gi|296100215|ref|YP_003617132.1| sex pilus assembly protein [Pseudomonas putida]
MSEPIKIPAYIDQPPHVMFWRLDEVMPIGIGLVAGVLLAQLILCTVVGLLLARFYRRFCDNRPDGYLLHA
IYWHWGAIGRKSVRSMPNSYEREFV
 
Nucleotide Sequence: 288 bp     [Download]
>gi|296100168|ref|NC_014124.1|:39975-40262 Pseudomonas putida plasmid pDK1, complete sequence
GTGAGCGAGCCAATCAAAATTCCGGCATACATCGACCAGCCGCCACACGTGATGTTTTGGCGTTTGGATG
AGGTCATGCCGATAGGGATCGGTTTGGTTGCAGGCGTTCTTCTGGCACAGCTGATTCTTTGCACAGTGGT
GGGTCTCCTGCTCGCTCGCTTCTATCGTCGCTTCTGCGACAACCGCCCTGACGGCTATCTGCTTCACGCC
ATTTACTGGCACTGGGGAGCCATTGGCCGGAAGAGTGTGCGATCCATGCCCAATTCCTACGAGAGAGAGT
TCGTCTGA
 Primer design