SecReT4
Protein ID: 296100216
T4SS name [ID]Tra_F [579]
Gene symboltrhE
Locus tagpDK1_p048
StrainPseudomonas putida plasmid pDK1 (NC_014124)
Repliconplasmid pDK1 [GenBank: NC_014124] [Browse all T4SS(s) in this replicon]
Location [Strand]40262..40903 [+]
Productsex pilus assembly protein
Component typeTraE_F
UniProt IDD5MPB5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 2.4e-12, Aligned region: 17..145
Protein Sequence: 213 a.a.     [Download]
>gi|296100216|ref|YP_003617133.1| sex pilus assembly protein [Pseudomonas putida]
MLFKSLSNSFDGMRGENQFLRIAVAGLVLSNLLVSCSALNKDEVVTVIPPTLTETAWVSKTQSSGEYADA
WALYIAMMLGNVTPHNASVVKDALGPILDKSIYQDTMKVLDTQIHQIRQDRVTLSFEPQKVLRDNLNENK
FYVTGRSVSEGPAGDKKRSNRTYEFELMIKDYKPVLSWVSTNSGDARTQDVVDRENSKAEKQAEREKRKN
QQR
 
Nucleotide Sequence: 642 bp     [Download]
>gi|296100168|ref|NC_014124.1|:40262-40903 Pseudomonas putida plasmid pDK1, complete sequence
ATGCTTTTTAAGTCGCTTAGCAATTCGTTCGATGGCATGCGCGGAGAAAATCAGTTTTTGCGCATTGCCG
TTGCTGGCCTTGTATTGAGCAATCTGCTGGTGTCTTGCTCTGCTCTCAACAAGGATGAAGTGGTCACCGT
GATACCACCTACCCTGACTGAGACCGCCTGGGTCAGTAAAACGCAAAGTTCCGGGGAGTACGCCGACGCA
TGGGCTCTTTACATCGCGATGATGCTAGGCAACGTCACCCCGCATAATGCCTCTGTCGTAAAAGATGCCC
TGGGGCCTATCCTCGATAAGTCGATCTATCAAGATACGATGAAGGTTCTCGATACTCAGATTCATCAGAT
CCGCCAGGATCGTGTGACCTTAAGCTTCGAGCCGCAGAAAGTGCTCCGCGATAACCTCAACGAGAACAAG
TTCTACGTTACCGGCCGCTCTGTGAGCGAAGGGCCGGCGGGCGACAAAAAGCGTAGCAATCGAACCTATG
AGTTCGAGCTTATGATCAAAGACTACAAGCCTGTCCTGAGCTGGGTTAGTACGAACTCTGGCGATGCTCG
AACCCAGGATGTGGTTGATCGCGAGAACAGCAAGGCGGAGAAACAAGCGGAGCGCGAGAAGAGAAAGAAT
CAGCAGCGCTAA
 Primer design