SecReT4
Protein ID: 296100218
T4SS name [ID]Tra_F [579]
Gene symboltrhK
Locus tagpDK1_p050
StrainPseudomonas putida plasmid pDK1 (NC_014124)
Repliconplasmid pDK1 [GenBank: NC_014124] [Browse all T4SS(s) in this replicon]
Location [Strand]41082..42122 [+]
Productsex pilus assembly protein
Component typeTraK_F
UniProt IDD5MPB7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 4.8e-48, Aligned region: 92..327
Protein Sequence: 346 a.a.     [Download]
>gi|296100218|ref|YP_003617135.1| sex pilus assembly protein [Pseudomonas putida]
MSLPVSLHFFKPAALVLAMAAVMPAIAQEQIQIPGMNMPVAASTQPQVVAKPADSPESVPERQEEPQGEK
KPRLVAITPGSVENPSVPASVVKKPTPVQPIESRQDVVVASGTNTLIPISRGQINRLVTPFDNPHIQTVS
EADISTSGNVIYVTTQDEKPVTMFVTPEDDESVAISLTLLPQGVPPIQANLILAQNVQGLASGMPVTSST
NYSGQARKWERSQPYMDTLRSLMREMALGKLPRGYSFGALTSGNKIPACAQPSLSFDFSKSQLIEGHDFR
VFVATAENVSARTVEFDHGSCTHPHRAAVSAWPDEVLEPGQKTEVFVVTRVPTEVPQSSTRPSLLQ
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|296100168|ref|NC_014124.1|:41082-42122 Pseudomonas putida plasmid pDK1, complete sequence
ATGTCACTTCCAGTTTCCCTCCATTTCTTCAAGCCAGCTGCGCTCGTATTGGCTATGGCTGCCGTAATGC
CTGCTATTGCCCAGGAGCAGATCCAGATACCAGGCATGAACATGCCAGTTGCTGCCAGCACGCAGCCTCA
AGTGGTTGCCAAGCCTGCGGATTCTCCAGAGAGCGTTCCTGAACGACAGGAAGAGCCGCAGGGGGAAAAG
AAACCACGTCTGGTTGCCATTACTCCGGGCTCTGTTGAAAACCCCAGTGTGCCGGCCAGCGTTGTGAAGA
AGCCCACTCCTGTTCAGCCCATCGAGTCTCGCCAGGATGTGGTCGTTGCAAGCGGCACAAACACCCTGAT
TCCGATCAGCAGAGGCCAAATCAACCGTCTGGTTACGCCGTTCGATAACCCTCATATCCAAACGGTAAGT
GAGGCTGATATTTCGACAAGTGGAAACGTCATCTACGTCACTACTCAGGATGAGAAGCCGGTGACCATGT
TCGTCACACCTGAGGACGATGAGTCTGTTGCAATTTCCCTGACGTTGCTGCCGCAGGGCGTACCTCCCAT
CCAGGCGAACCTGATCCTGGCGCAAAACGTACAAGGGCTGGCGAGCGGCATGCCCGTAACCTCGTCGACG
AACTACAGCGGCCAGGCGCGGAAGTGGGAACGCTCTCAGCCATATATGGACACTCTTCGCTCCCTCATGC
GCGAAATGGCGCTAGGCAAGTTGCCGCGTGGATACAGCTTCGGTGCGCTTACCAGCGGCAACAAGATCCC
CGCCTGTGCGCAGCCAAGCCTCAGCTTCGATTTCAGCAAGTCGCAGTTGATCGAGGGCCATGACTTCAGA
GTCTTCGTGGCCACCGCCGAAAACGTGTCGGCCAGAACCGTTGAGTTCGATCACGGCTCGTGCACTCACC
CTCACCGAGCAGCTGTAAGCGCATGGCCAGATGAGGTGCTTGAACCTGGCCAGAAAACAGAAGTGTTTGT
CGTCACTCGGGTTCCGACCGAAGTACCGCAAAGCTCCACTCGTCCAAGCCTGTTGCAGTAA
 Primer design