SecReT4
Protein ID: 296100219
T4SS name [ID]Tra_F [579]
Gene symboltrhB
Locus tagpDK1_p051
StrainPseudomonas putida plasmid pDK1 (NC_014124)
Repliconplasmid pDK1 [GenBank: NC_014124] [Browse all T4SS(s) in this replicon]
Location [Strand]42135..43451 [+]
Productsex pilus assembly protein
Component typeTraB_F
UniProt IDD5MPB8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.3e-46, Aligned region: 215..423
Protein Sequence: 438 a.a.     [Download]
>gi|296100219|ref|YP_003617136.1| sex pilus assembly protein [Pseudomonas putida]
MKAIQQFLEKLTPRGKLMLAIGGTVLVVGTIVGVAMNAASPERKARAAAKPQVEAILTDEDPRALGLDSI
ASQLRQLQAQQNRLERVMGQKEKDVQLKNTQEKVSGLEQELQLLQQELARVGREKKGTGESGDNSSDSST
ANQARSPIPPRESAFINKVTSSPADLTDVYSNLPPEQPEDPKSRSSEKKETPKIRVIKGKEDEGKSDKPE
ELSVTLPAGSILSGVLVTGMDAPTGKQAQRDPFPSLIRIKNEAILPNRFRADFRECFLIAGGWGDLSSER
AYLRAERLSCVRNDGSVLESSLEAYATGEDGKAGIRGRLVSKQGQILARSLMAGFMQGVASAFNVQKVPT
INVTRAGDNGDTVAPVYEQAFDSNALQSAGFSGAGTALERVADFYLEMAESIFPVIEIDAMRDVDFIVNK
GMTVKFNAATLKVNDVNN
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|296100168|ref|NC_014124.1|:42135-43451 Pseudomonas putida plasmid pDK1, complete sequence
GTGAAAGCGATTCAGCAATTCCTCGAAAAACTCACGCCCAGAGGCAAGCTGATGCTTGCCATCGGTGGGA
CGGTTCTGGTCGTGGGTACTATCGTTGGCGTCGCCATGAACGCGGCGAGCCCCGAGCGCAAGGCACGCGC
AGCGGCAAAGCCTCAGGTAGAGGCCATCCTCACCGATGAAGACCCCCGCGCGTTGGGCTTGGACTCGATC
GCCAGCCAACTGCGACAGCTCCAGGCGCAGCAAAACCGCCTTGAGCGCGTGATGGGGCAGAAAGAAAAGG
ACGTTCAGCTCAAAAATACGCAAGAAAAAGTAAGCGGCCTGGAGCAAGAACTCCAGTTGCTTCAGCAGGA
GCTGGCGCGGGTTGGACGGGAAAAGAAAGGCACTGGTGAGAGTGGTGATAACTCGTCCGACAGCTCCACC
GCCAACCAGGCGCGTTCCCCTATCCCCCCTCGCGAATCGGCATTCATCAACAAAGTAACAAGCTCGCCGG
CAGATCTGACTGACGTTTACTCGAACCTGCCACCTGAGCAACCGGAAGACCCTAAGTCGCGATCAAGCGA
GAAAAAGGAAACGCCCAAGATCCGTGTGATCAAGGGCAAGGAAGACGAGGGAAAGAGCGACAAGCCTGAG
GAGCTATCTGTGACGCTGCCCGCTGGATCGATCTTGTCTGGCGTCTTGGTCACAGGTATGGACGCGCCAA
CTGGAAAGCAGGCACAACGCGACCCTTTCCCGAGCCTGATCCGCATCAAGAATGAAGCAATCCTTCCTAA
CCGCTTCAGGGCTGATTTTCGCGAATGCTTCCTGATCGCCGGCGGCTGGGGTGACCTCAGCTCGGAAAGA
GCCTATCTGCGAGCGGAGCGCCTGTCGTGCGTACGCAATGATGGTTCGGTGCTGGAGTCCAGCCTGGAGG
CATACGCAACGGGCGAGGATGGGAAGGCAGGCATCCGTGGCCGTTTGGTTAGCAAGCAGGGCCAAATCCT
TGCAAGAAGCCTTATGGCTGGCTTCATGCAGGGGGTCGCGAGTGCTTTCAACGTTCAAAAGGTACCGACC
ATCAACGTCACCCGCGCTGGAGATAACGGCGACACCGTTGCTCCTGTTTACGAGCAGGCATTCGATAGCA
ATGCACTTCAGTCGGCCGGCTTCAGTGGGGCGGGGACGGCTCTTGAGCGAGTCGCCGACTTCTATCTCGA
GATGGCTGAAAGCATCTTCCCTGTTATTGAAATCGACGCAATGCGTGATGTTGATTTTATCGTCAATAAA
GGCATGACCGTTAAGTTCAATGCAGCAACTCTCAAAGTCAATGACGTAAACAATTAA
 Primer design