SecReT4
Protein ID: 296100220
T4SS name [ID]Tra_F [579]
Gene symboltrhV
Locus tagpDK1_p052
StrainPseudomonas putida plasmid pDK1 (NC_014124)
Repliconplasmid pDK1 [GenBank: NC_014124] [Browse all T4SS(s) in this replicon]
Location [Strand]43462..43962 [+]
Productsex pilus assembly protein
Component typeTraV_F
UniProt IDD5MPB9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 4.3e-23, Aligned region: 26..138
Protein Sequence: 166 a.a.     [Download]
>gi|296100220|ref|YP_003617137.1| sex pilus assembly protein [Pseudomonas putida]
MIKKIILVSAIAALTTGCTNLLNVGSSEYACKGMPSGVTCMSAKDVYSATEGDDYKTQLKQEQEGVEAGS
DKSTGTGATRVLIAEGSDNAPMPMRARNPLPIRSQAVVMRIAIDPWEDEKGDLYVPGFIYTEVEARRWEI
GARTPQATPTLRPLTIVQPPQANSAK
 
Nucleotide Sequence: 501 bp     [Download]
>gi|296100168|ref|NC_014124.1|:43462-43962 Pseudomonas putida plasmid pDK1, complete sequence
ATGATTAAGAAAATTATCCTTGTAAGCGCAATTGCTGCATTGACTACTGGCTGCACGAATCTTCTCAACG
TAGGCTCAAGTGAGTATGCATGTAAAGGTATGCCGAGCGGCGTTACTTGCATGTCCGCAAAAGATGTTTA
TTCGGCAACTGAGGGTGATGACTACAAAACCCAGTTGAAGCAAGAACAAGAAGGCGTTGAGGCCGGCAGT
GATAAATCAACAGGTACCGGCGCAACGCGCGTGCTTATCGCAGAAGGATCGGACAACGCCCCAATGCCGA
TGAGAGCGAGAAATCCTCTTCCGATCCGCTCGCAGGCTGTAGTCATGCGTATCGCAATTGATCCATGGGA
GGACGAGAAAGGCGATCTGTATGTTCCTGGCTTCATTTATACCGAAGTGGAAGCGCGTCGCTGGGAGATC
GGTGCTCGAACCCCTCAGGCAACACCAACCTTGCGTCCCCTCACGATCGTTCAGCCGCCGCAGGCTAATT
CTGCCAAGTAG
 Primer design