SecReT4
Protein ID: 296100222
T4SS name [ID]Tra_F [579]
Gene symboltrhA
Locus tagpDK1_p054
StrainPseudomonas putida plasmid pDK1 (NC_014124)
Repliconplasmid pDK1 [GenBank: NC_014124] [Browse all T4SS(s) in this replicon]
Location [Strand]51627..51971 [+]
Productsex pilus assembly protein
Component typeTraA_F
UniProt IDD5MPC1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 7.8e-07, Aligned region: 3..89
Protein Sequence: 114 a.a.     [Download]
>gi|296100222|ref|YP_003617139.1| sex pilus assembly protein [Pseudomonas putida]
MHVNKATLQTMAIAAAMVVAGTALAGTGGDTFDSVWITLTEWMQGTLGRILIGLMILTGIGAGVLRQSLM
PFVTGVGGGVGLYAAPDVIESVMSATIPAAAVVTNALQALPVGF
 
Nucleotide Sequence: 345 bp     [Download]
>gi|296100168|ref|NC_014124.1|:51627-51971 Pseudomonas putida plasmid pDK1, complete sequence
ATGCACGTCAACAAAGCAACCCTCCAAACGATGGCCATCGCAGCGGCAATGGTGGTCGCCGGTACCGCGC
TCGCCGGTACCGGCGGCGATACGTTCGATAGCGTGTGGATTACCTTGACCGAGTGGATGCAAGGTACCCT
CGGCCGCATTCTGATCGGTCTGATGATCCTCACCGGCATCGGCGCGGGCGTTCTCCGCCAATCGCTTATG
CCGTTCGTTACTGGCGTTGGCGGCGGCGTTGGCCTCTATGCTGCGCCGGATGTTATCGAGTCGGTAATGT
CGGCAACTATCCCAGCAGCAGCTGTAGTCACCAACGCTCTCCAAGCCCTGCCTGTAGGCTTCTGA
 Primer design