SecReT4
Protein ID: 296100224
T4SS name [ID]Tra_F [579]
Gene symboltrhC
Locus tagpDK1_p056
StrainPseudomonas putida plasmid pDK1 (NC_014124)
Repliconplasmid pDK1 [GenBank: NC_014124] [Browse all T4SS(s) in this replicon]
Location [Strand]52815..55280 [+]
Productsex pilus assembly protein
Component typeTraC_F
UniProt IDD5MPC3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 8.7e-51, Aligned region: 9..254
AAA_10 [PF12846], Evalue: 4.7e-50, Aligned region: 450..729
Protein Sequence: 821 a.a.     [Download]
>gi|296100224|ref|YP_003617141.1| sex pilus assembly protein [Pseudomonas putida]
MLKALIRSTPRLSKLINGLAYEPNLYLFQLEGNRLGFAFLCSPLSGSNGDEGDRLKAGLTVDWPEKTTIQ
FSLICTENINEMKTGFLRLRRAFRESGRTDLPVETQALLEKVTNARAEYFSDRTMRPVDSISGVRIREQS
LVVSVTIPIANALPTQTEANAAKELFDGLRTSLDSCNLAAVPLTNDSYREIFSSILNQGPSASWREDPDM
KADTDKPLNEQILDYNRSLDVKKDHLQIGDDCFVKTLSAKRFPDVMWQGDASQYLADILSQRGGIRGNCI
INMTLYFPPQLETKDKLSKRRQWAINQSFGPMVHFVPVLRKTKEAYDTLFEDLDKGLPNVQATMTLVVFG
RNREDLIQAASNAKSHFATQGFSLMEDKFCVLPVFVNSLPMCADPDAMRELFRFKTLSLTQALPLLPIYG
DWKGTGTQVAPFISRNGQPVSFNLFDSDTNYNAMIAAQSGSGKSFATNYLITSYLSIGAKVWVIDVGLSY
LKLSEAYKGDFARFDQESNLCLNPFELIEDYSEEEDVLVGLLSAMAAPTVPLIDFQTAGLKRHLTQCWEE
LGKTMIVDNIADSLLGDPDPRIQDIGHQLFAFTSKGQYGRFFNGKNNLNFKNPFTVLELEELKGRQHLQQ
VVLLQLIYQIQQDMYLGERDRPKIVIIDEAWSLLSQGNVGEFIEHGYRRFRKYGGSAIVITQGVNDLYQN
KVGQAIAENSAFTLLLGQKAEAIDAIQENKRLPLGEGGYRILKTVKSYKGHYSEIFMLTPRGAGIVRLTV
DPYSILLYSTAPEDVQAIRNYTLTGVPQDEAILRVLRDRGVEYSSNPAEVA
 
Nucleotide Sequence: 2466 bp     [Download]
>gi|296100168|ref|NC_014124.1|:52815-55280 Pseudomonas putida plasmid pDK1, complete sequence
ATGCTCAAAGCGCTTATCCGCTCAACACCGCGGCTCTCGAAGCTGATCAACGGCCTCGCCTACGAGCCGA
ATCTTTACCTGTTCCAGCTGGAAGGGAACCGCCTAGGATTCGCATTCCTGTGTTCCCCGCTCTCAGGCTC
AAACGGGGATGAAGGCGACCGCCTGAAGGCTGGTTTGACGGTCGACTGGCCTGAGAAGACAACAATCCAG
TTCAGCCTGATTTGCACTGAAAATATCAATGAGATGAAGACGGGATTCCTTCGCCTGCGTCGGGCCTTCC
GTGAATCTGGCCGCACTGACCTTCCCGTGGAAACCCAAGCCTTGCTGGAGAAAGTGACGAACGCGCGGGC
CGAGTATTTCAGTGACCGAACCATGCGCCCAGTTGATTCAATCTCAGGTGTACGCATTCGTGAACAGAGC
CTGGTCGTATCCGTAACAATTCCGATCGCCAATGCGTTGCCTACCCAGACAGAAGCGAACGCGGCGAAGG
AGCTTTTCGACGGACTGCGAACCTCGCTGGACAGCTGCAACCTGGCAGCCGTGCCGCTCACCAACGATTC
CTACCGTGAAATTTTCTCCTCCATCCTGAACCAAGGGCCATCGGCGTCGTGGCGCGAAGATCCGGACATG
AAGGCGGACACAGACAAGCCCCTGAATGAGCAGATCCTCGACTACAACCGCAGCCTCGACGTGAAGAAAG
ACCACCTTCAGATCGGAGATGACTGCTTTGTAAAAACGCTGTCGGCCAAGCGCTTCCCTGATGTCATGTG
GCAGGGCGATGCCTCTCAGTACCTCGCTGACATTCTGTCCCAGCGCGGCGGAATCCGGGGTAACTGCATC
ATCAACATGACCCTGTATTTCCCTCCCCAGCTGGAAACAAAGGACAAGCTGTCGAAGCGCCGCCAATGGG
CCATCAACCAGAGCTTCGGCCCGATGGTGCATTTCGTACCCGTTCTACGGAAGACGAAGGAAGCCTATGA
CACGCTGTTTGAAGATCTCGACAAAGGGCTTCCCAACGTACAGGCGACAATGACCCTCGTGGTATTCGGC
CGGAACCGGGAAGACCTCATTCAGGCAGCGTCGAATGCGAAGAGCCATTTTGCCACGCAGGGCTTCAGCC
TCATGGAGGACAAGTTCTGTGTGCTGCCCGTGTTCGTGAACTCCCTGCCTATGTGTGCCGACCCGGATGC
GATGAGGGAGCTGTTCCGGTTCAAGACATTGAGCCTCACCCAGGCATTACCTTTGCTGCCGATCTATGGC
GATTGGAAGGGCACTGGAACCCAAGTGGCCCCGTTCATTTCCCGAAACGGTCAGCCGGTTAGCTTCAACC
TCTTTGACTCCGACACCAATTACAACGCGATGATCGCGGCCCAGTCGGGCTCCGGTAAGTCGTTTGCGAC
CAACTATCTCATCACGTCGTATCTGAGCATTGGAGCGAAGGTGTGGGTCATCGACGTGGGCCTGTCCTAC
CTAAAGCTGTCTGAGGCGTACAAGGGCGACTTTGCACGCTTTGACCAGGAGTCGAATCTCTGTCTCAACC
CCTTCGAGCTGATTGAAGACTACAGCGAGGAAGAGGATGTCCTGGTTGGGCTGCTCTCTGCTATGGCTGC
CCCAACCGTGCCCCTGATCGACTTCCAAACCGCCGGGCTAAAGAGGCACCTCACGCAATGCTGGGAAGAG
TTGGGCAAGACGATGATCGTCGACAACATCGCTGATTCTCTGCTTGGCGACCCAGACCCGCGTATTCAAG
ACATTGGCCATCAGCTCTTCGCATTCACCTCGAAGGGGCAGTACGGCCGTTTCTTTAACGGCAAGAACAA
TCTCAACTTCAAGAATCCCTTCACCGTACTCGAGCTTGAGGAACTGAAGGGTCGCCAACACCTTCAGCAA
GTTGTGCTCCTTCAGCTGATCTACCAAATCCAGCAGGACATGTACCTTGGTGAGCGTGACCGCCCGAAAA
TTGTGATCATTGATGAAGCCTGGTCGCTGCTCTCCCAGGGCAACGTTGGTGAATTCATTGAGCACGGTTA
CCGGCGATTCCGGAAATATGGCGGTAGTGCCATTGTCATTACCCAGGGGGTCAACGACCTCTATCAGAAC
AAAGTCGGACAGGCCATTGCTGAAAACTCCGCGTTCACCCTCCTACTCGGTCAAAAGGCCGAAGCTATTG
ATGCTATCCAGGAAAACAAGCGTCTGCCGCTGGGAGAGGGTGGCTATCGAATCCTGAAGACTGTTAAGTC
GTACAAGGGGCATTACTCAGAGATCTTCATGCTCACCCCCCGCGGGGCCGGTATCGTGCGCCTCACGGTG
GACCCATATTCGATCCTCCTCTACTCGACCGCACCTGAAGATGTGCAGGCGATCCGAAACTACACGCTCA
CCGGCGTTCCGCAGGATGAGGCAATTCTGCGCGTGCTCCGTGACCGAGGTGTCGAGTACAGCTCTAATCC
GGCGGAAGTCGCGTAA
 Primer design