SecReT4
Protein ID: 296100226
T4SS name [ID]Tra_F [579]
Gene symboltrhW
Locus tagpDK1_p058
StrainPseudomonas putida plasmid pDK1 (NC_014124)
Repliconplasmid pDK1 [GenBank: NC_014124] [Browse all T4SS(s) in this replicon]
Location [Strand]55846..57087 [+]
Productsex pilus assembly protein
Component typeTraW_F
UniProt IDD5MPC5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 1.8e-22, Aligned region: 110..229
Protein Sequence: 413 a.a.     [Download]
>gi|296100226|ref|YP_003617143.1| sex pilus assembly protein [Pseudomonas putida]
MVKKQLAMCIGLAFSCTMAIAGDDLGIRKYDINEFDPALLDQVREISRNAKAAREEVSGRDDMSWVSEMA
EKAIVQGSDEEAQQNDSGLASADGSDREKKHPLGDGNRTLIFVSWSMGATALKDILLSFDGLPGVGIVFR
GIPDGMSMGDAVTKMHLLTQETQSTVSVLLDPLAFQRHSVSAVPTVALEAPNDALIAKAAGSSSISYIEG
AVKDGKRGDLGTIGSTQEIIEPDLMEVAKQRIAELDTDAMKKRAIARFWDNHKGHPLPPVTESATRLVDA
SVIVPDDILDSQGRVVQKAGRINPLDMMPFDQKLVVIDPTQPWQVALAKREYADHGANLTVTVMATQIPT
ASGWDLFNSVQDSLDAPLYLLPPDMAERFQILRAPSVVTADTKNFIVREVAQTAFEEANHEHQ
 
Nucleotide Sequence: 1242 bp     [Download]
>gi|296100168|ref|NC_014124.1|:55846-57087 Pseudomonas putida plasmid pDK1, complete sequence
ATGGTGAAAAAGCAACTAGCCATGTGCATTGGGCTGGCCTTCAGCTGCACGATGGCCATCGCCGGCGATG
ACCTTGGCATTCGTAAGTACGACATCAATGAATTCGATCCTGCGCTCCTCGATCAGGTCAGGGAAATCAG
CCGAAATGCGAAAGCCGCGCGCGAAGAAGTAAGCGGCCGAGATGACATGAGTTGGGTGAGTGAGATGGCC
GAAAAGGCCATCGTTCAAGGCAGTGATGAAGAAGCCCAGCAGAACGATTCAGGGCTCGCCAGCGCAGATG
GCTCAGATCGCGAGAAAAAACATCCCCTGGGCGATGGAAACCGCACTCTAATTTTCGTGTCGTGGTCGAT
GGGGGCTACTGCCCTCAAAGACATACTGCTGTCCTTTGACGGACTGCCTGGTGTTGGCATCGTTTTTCGA
GGCATTCCTGATGGTATGTCGATGGGCGATGCTGTGACCAAAATGCACCTCCTCACGCAAGAGACGCAAA
GCACTGTGAGTGTTCTGCTCGATCCTCTCGCATTCCAGCGTCATAGCGTTTCAGCCGTCCCCACCGTCGC
TCTCGAAGCACCGAATGATGCTTTGATCGCTAAAGCTGCTGGGTCGTCCTCTATTAGCTATATCGAGGGG
GCGGTTAAGGATGGTAAGCGTGGGGATCTAGGCACTATTGGCTCTACACAGGAAATCATCGAGCCAGACC
TCATGGAGGTTGCGAAACAGCGCATCGCAGAGCTGGACACCGACGCCATGAAAAAGCGAGCAATCGCCCG
GTTTTGGGATAACCACAAAGGGCATCCATTGCCGCCGGTAACGGAGAGTGCCACCCGCCTCGTCGATGCA
TCGGTCATTGTTCCCGATGACATTCTCGATAGCCAAGGCAGGGTTGTTCAGAAGGCAGGGAGGATTAATC
CACTCGACATGATGCCTTTTGACCAGAAACTGGTCGTGATTGATCCGACGCAACCTTGGCAGGTTGCCCT
GGCGAAGCGTGAATATGCAGACCATGGGGCAAATCTGACCGTCACGGTGATGGCGACTCAGATTCCCACT
GCCTCTGGTTGGGATCTGTTCAACAGCGTTCAGGACAGCCTGGATGCGCCCTTGTACCTGCTGCCGCCTG
ACATGGCGGAGCGCTTCCAAATCCTTCGAGCCCCATCTGTCGTAACAGCCGACACCAAAAACTTTATCGT
CCGCGAGGTTGCTCAAACAGCCTTCGAGGAGGCCAATCATGAGCATCAATAA
 Primer design