SecReT4
Protein ID: 296100227
T4SS name [ID]Tra_F [579]
Gene symboltrhU
Locus tagpDK1_p059
StrainPseudomonas putida plasmid pDK1 (NC_014124)
Repliconplasmid pDK1 [GenBank: NC_014124] [Browse all T4SS(s) in this replicon]
Location [Strand]57044..58126 [+]
Productsex pilus assembly protein
Component typeTraU_F
UniProt IDD5MPC6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 4.7e-66, Aligned region: 56..358
Protein Sequence: 360 a.a.     [Download]
>gi|296100227|ref|YP_003617144.1| sex pilus assembly protein [Pseudomonas putida]
MLKQPSRRPIMSINKVITAAILVMAGMFSLPGIAAEASSSGEVMCEDSGLFGPKLFTDICWACLFPIRVS
GVQITPGTAPAKATKMVFCICQQGSSSIYKPGIITAMWEPARMVETVRKPGCSPTLGGVTLPLGNKRSYG
RLRQDNSTQTGQAAGSFYHAHLYAFPLLQILDLYTPTKCNPDGYLDLDIISFTEIDPTWNNGTLAFFQHP
ESAAVANPIAIAACAAESALVTARKEPLESLWWCTGTWGSIYPFAGVTVAQDANRTTALLAARVIAQQHR
RGLARRTMGDENVCKAGIYPTIPKSQYKVTQFWPKSQNSRAMWLGEPPQTWEGGPSRHVPGTGNDAMYMF
WRWTDCCSKL
 
Nucleotide Sequence: 1083 bp     [Download]
>gi|296100168|ref|NC_014124.1|:57044-58126 Pseudomonas putida plasmid pDK1, complete sequence
TTGCTCAAACAGCCTTCGAGGAGGCCAATCATGAGCATCAATAAGGTAATAACCGCCGCAATTCTGGTGA
TGGCAGGCATGTTTTCCCTGCCAGGGATAGCGGCTGAGGCGTCCTCTTCCGGAGAGGTGATGTGTGAGGA
CTCTGGCCTTTTTGGTCCGAAGTTGTTCACCGACATCTGCTGGGCGTGCCTCTTCCCAATTCGTGTTTCT
GGTGTGCAAATAACCCCCGGCACAGCCCCCGCGAAGGCTACAAAAATGGTCTTCTGCATCTGCCAGCAAG
GCTCATCCTCGATCTACAAGCCCGGAATCATCACTGCAATGTGGGAGCCGGCACGGATGGTTGAAACTGT
CCGTAAGCCAGGCTGCTCGCCAACCCTAGGTGGTGTAACGCTGCCGCTTGGCAACAAGCGCAGCTATGGC
CGACTTCGGCAGGACAACAGCACCCAGACAGGTCAGGCTGCCGGGTCGTTCTACCACGCGCATCTGTATG
CATTCCCGCTACTTCAGATCCTCGATCTCTATACGCCTACCAAATGCAACCCGGACGGTTATCTCGACCT
CGATATCATCTCTTTCACTGAGATCGACCCGACCTGGAACAACGGTACGTTGGCTTTCTTCCAGCACCCC
GAGTCCGCGGCCGTGGCAAACCCAATCGCTATTGCGGCCTGTGCTGCCGAATCCGCGCTGGTTACCGCTC
GAAAGGAACCTCTTGAGTCGCTTTGGTGGTGTACCGGTACATGGGGGAGCATCTACCCATTTGCCGGCGT
AACCGTGGCGCAAGATGCAAACCGGACGACAGCATTGCTGGCTGCGCGAGTGATCGCTCAGCAACACCGC
AGGGGCCTCGCTCGACGCACTATGGGTGATGAAAACGTGTGCAAGGCGGGTATCTACCCGACGATTCCGA
AAAGCCAGTACAAAGTGACCCAGTTCTGGCCAAAGTCGCAGAACAGCAGAGCAATGTGGCTCGGAGAACC
GCCGCAGACTTGGGAGGGTGGGCCTAGTCGGCATGTTCCAGGTACTGGGAACGATGCCATGTACATGTTC
TGGCGATGGACAGATTGCTGCTCGAAGCTCTAA
 Primer design