SecReT4
Protein ID: 296100233
T4SS name [ID]Tra_F [579]
Gene symboltrhF
Locus tagpDK1_p065
StrainPseudomonas putida plasmid pDK1 (NC_014124)
Repliconplasmid pDK1 [GenBank: NC_014124] [Browse all T4SS(s) in this replicon]
Location [Strand]62424..63449 [+]
Productsex pilus assembly protein
Component typeTraF_F
UniProt IDD5MPD2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 6.8e-64, Aligned region: 46..276
Protein Sequence: 341 a.a.     [Download]
>gi|296100233|ref|YP_003617150.1| sex pilus assembly protein [Pseudomonas putida]
MTPLKFPMLLLAAAISSTSLAGETKPAESKTPQVAGSSFYQDKERGWFWYEDPPPEQEPEKLEPAPVPAP
PPQAETEASEPAAPELPPTGSVAWIREMLPKLRDAAMDNPTKENVSAYFWAQRIMLDKAERFSRHSVDVI
RNDPFLDEDMRYPASNAASDALATAAGKQKETLLKLIAGSSALMFFYNGNDCILCEQALAAVSALEFRYG
FTVMPVSMDGAPLPGGKYPNTQYDTGLAEQLGIITSPALALVIPPNDVKIVSFSTVSMETATTRILMAAN
EAGLISDQEYNATSRLNTMGLIDATKLADAPPDATKNPNEFVNRMRDEARRAFQKDNGGAQ
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|296100168|ref|NC_014124.1|:62424-63449 Pseudomonas putida plasmid pDK1, complete sequence
ATGACGCCCCTAAAATTTCCCATGTTGTTGCTTGCTGCCGCTATAAGCAGCACTTCCCTTGCGGGAGAGA
CCAAGCCCGCCGAGTCAAAAACGCCCCAGGTTGCTGGTTCTTCGTTCTACCAGGACAAAGAGCGCGGCTG
GTTCTGGTACGAAGATCCGCCTCCTGAACAGGAACCCGAAAAGCTCGAGCCCGCACCGGTTCCAGCGCCC
CCACCTCAAGCCGAAACGGAAGCCTCCGAGCCAGCCGCGCCCGAGCTGCCACCGACCGGCAGTGTGGCGT
GGATTCGCGAAATGCTTCCGAAACTGCGTGATGCAGCCATGGATAACCCCACCAAGGAGAATGTGAGTGC
GTACTTCTGGGCTCAGCGAATCATGCTCGACAAGGCCGAGCGATTCTCACGTCACTCCGTCGACGTAATC
CGTAATGACCCATTCCTCGACGAGGATATGCGTTATCCCGCCTCCAACGCCGCTTCTGACGCTCTAGCAA
CTGCGGCCGGCAAGCAGAAAGAAACCCTGTTGAAGCTCATCGCTGGCAGCTCTGCGCTGATGTTCTTCTA
CAACGGTAACGACTGCATTTTGTGCGAACAGGCCCTGGCAGCGGTCTCTGCTCTCGAGTTCAGGTACGGG
TTTACTGTCATGCCCGTCTCGATGGATGGGGCCCCCCTTCCTGGCGGCAAATACCCAAACACACAGTACG
ACACTGGGCTCGCAGAGCAGCTGGGCATCATCACCTCGCCGGCGCTGGCCCTAGTCATCCCTCCGAATGA
CGTGAAGATCGTCAGCTTCAGCACCGTTTCAATGGAGACGGCAACCACTCGGATTTTAATGGCGGCGAAT
GAAGCGGGGCTGATTTCCGATCAGGAATACAACGCCACATCCCGCCTTAACACCATGGGTTTGATCGACG
CCACGAAACTGGCTGACGCACCGCCCGACGCAACAAAAAACCCTAACGAATTCGTGAATCGGATGCGCGA
TGAAGCTCGTCGCGCCTTTCAAAAAGACAACGGAGGTGCCCAGTGA
 Primer design