SecReT4
Protein ID: 296100234
T4SS name [ID]Tra_F [579]
Gene symboltrhH
Locus tagpDK1_p066
StrainPseudomonas putida plasmid pDK1 (NC_014124)
Repliconplasmid pDK1 [GenBank: NC_014124] [Browse all T4SS(s) in this replicon]
Location [Strand]63446..64846 [+]
Productsex pilus assembly protein
Component typeTraH_F
UniProt IDD5MPD3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 4.9e-94, Aligned region: 26..388
Protein Sequence: 466 a.a.     [Download]
>gi|296100234|ref|YP_003617151.1| sex pilus assembly protein [Pseudomonas putida]
MKIKPIALAVALMVPFGAHANIQQQVNEMFSGMINVTSPGAYKTATRGVITGGSVVLRNRISTANLISIT
PPSAKGGCGGINLYSGSFSFINGEEFVALMRNVASNAAGIVSGFAFELALDAMDAQTGGVIRNLANKIQA
LNQMFSNSCQLASGLVTNAKKAYEESTDFKSAMTAFGSNVSSDFFTAKSTKEDSPANRIAASGKAVQCEN
TGNVLWCAMMKSGLQSQILFGSDENAEFIMSMVGSYNVSLTNDASGGKNFAAHPMPKLITGEGLKILVEG
STNLDVKVYQCDQDDPDCSDPNIRTLTSFKGLETRILEDLQNNGILERFANGTATAADGNRIAYLASSRV
GVNLMKITQKAGAQSGYDYLNQFAKKIAADASMSLIYQLLGHTEKGLTSLNMADAGKVIEDLRATKGELM
DEYRSYIEDAMQGKDADGQAEKMLQMAPVFDSGTLPQGTINDNAGA
 
Nucleotide Sequence: 1401 bp     [Download]
>gi|296100168|ref|NC_014124.1|:63446-64846 Pseudomonas putida plasmid pDK1, complete sequence
GTGAAAATCAAACCGATCGCCCTTGCTGTAGCGCTGATGGTGCCCTTCGGGGCTCACGCGAACATTCAAC
AGCAGGTCAATGAAATGTTCAGCGGCATGATCAACGTCACCAGTCCAGGGGCATATAAAACAGCCACACG
CGGCGTTATTACCGGCGGCTCCGTTGTCCTTCGGAATCGGATATCCACTGCCAACCTCATCAGCATTACC
CCGCCAAGCGCAAAGGGTGGATGCGGGGGGATCAACCTTTACAGTGGCTCGTTCTCCTTTATCAACGGCG
AAGAGTTCGTAGCGCTCATGAGGAATGTGGCGTCGAACGCTGCTGGCATTGTTTCGGGCTTTGCCTTTGA
ATTGGCCCTCGATGCGATGGACGCTCAGACAGGTGGCGTGATCCGCAACCTGGCCAACAAGATCCAGGCG
CTCAATCAAATGTTTTCCAACAGCTGCCAGCTGGCGAGTGGGTTGGTTACGAATGCCAAAAAGGCATACG
AAGAAAGCACCGATTTCAAATCCGCGATGACGGCCTTCGGGTCGAACGTCTCATCTGACTTCTTTACCGC
GAAATCCACCAAAGAAGACTCGCCAGCGAACCGGATTGCTGCCTCTGGTAAGGCCGTTCAATGCGAGAAC
ACAGGGAACGTTCTGTGGTGCGCCATGATGAAGTCTGGCCTCCAGTCGCAGATCCTATTCGGCAGCGATG
AAAACGCGGAATTCATCATGTCGATGGTCGGCAGCTACAACGTGTCGCTCACCAACGACGCCAGCGGGGG
AAAAAACTTCGCTGCGCATCCCATGCCGAAGCTCATCACCGGCGAAGGTCTGAAGATTCTGGTTGAAGGC
TCAACCAATCTCGATGTCAAGGTCTACCAGTGCGACCAGGATGACCCTGACTGCTCAGACCCGAACATCC
GTACTCTCACCAGCTTCAAGGGCCTCGAAACCCGAATCCTTGAGGATCTTCAAAACAATGGAATCCTTGA
GCGTTTTGCCAACGGCACTGCAACCGCTGCTGACGGAAACCGGATTGCATACCTCGCATCAAGCCGCGTA
GGGGTGAATCTGATGAAAATCACCCAGAAGGCAGGGGCTCAATCCGGTTATGACTATCTGAATCAGTTCG
CCAAGAAAATTGCTGCTGATGCATCGATGAGCCTGATCTACCAGCTGCTTGGGCACACAGAGAAGGGCCT
GACCAGCCTAAACATGGCGGATGCTGGGAAGGTGATCGAGGATCTGCGGGCTACAAAGGGTGAGCTCATG
GACGAATACCGCTCGTACATCGAGGACGCAATGCAGGGCAAAGATGCCGATGGCCAAGCAGAAAAAATGC
TCCAGATGGCCCCTGTGTTTGATAGCGGAACTCTGCCGCAGGGAACCATCAACGATAACGCAGGCGCGTA
A
 Primer design