SecReT4
Protein ID: 296100235
T4SS name [ID]Tra_F [579]
Gene symboltrhG
Locus tagpDK1_p067
StrainPseudomonas putida plasmid pDK1 (NC_014124)
Repliconplasmid pDK1 [GenBank: NC_014124] [Browse all T4SS(s) in this replicon]
Location [Strand]64858..68265 [+]
Productsex pilus assembly protein
Component typeTraG_F
UniProt IDD5MPD4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 2.4e-104, Aligned region: 4..474
Protein Sequence: 1135 a.a.     [Download]
>gi|296100235|ref|YP_003617152.1| sex pilus assembly protein [Pseudomonas putida]
MDFTIYTTGSAEFLEIMLNACAMITGSGDAEDLARIGALIGLFLLAFQAVFNNQAITFGKAGLVLVLYMM
FYGPTATTVIEDTVSSQVRVVDNVPLGPAFVGSVISTVAYGITKTAEQAFSTPSMTDYGLFSSLSTLSKV
RDALRNPMALDGFQNYRKADGWDLPRSVNEYMTFCSLNPVALRTDKTLTDLYRSPGWAEVLSNQNSSMFI
YVYDGTAGTMKSCAEARSFLNAHLQNVYTDVLEDILQKGFSEEAKTNRMTSGIQVQAATDQAIQSLALSS
KSAQDYVLTSLIAPIFNDSRVDAMNHWQEQRAAMALRESLNQQEIQWAGKGDSFKHYMRPMIAFFEGMLY
AMTPFMAFALLLGGPGLSILGKYLVLPLAVGLWMPLLSIVNAFTLWYAGSQMEAVFNGYDPTGSGFAMLQ
LMDIDKAIGKALGIGGLLAASVPPLALFIVSGSAMVANSVMSQMTAGDKFKSEDVTPRSQESAPVLSTNA
SFTSDQVSAGVAKTGTPQLAETISSEQAASAVVQSANMASQTATSQYQESLKAAGQQLNSSATGRQALAQ
IGENLSAGSVLSSNASYNEAKESLRSLGFSESSLNQATSNAAMGISTPLGGMKRSDNTSADTMTQESRAK
AEKALAQLTQSVQATDSSTLTFATGDAFSSSALAQQSASNTDEIGKTRSSALQAQQTYSQASAQQDSIKA
GQSLNLRDAGVKALTRGLGRNETALALEKMAGQTESGKDLYKQAFGSQSIQDMSKDTSERRAMAAIRAIN
QDGRLGELLMSPYNPFDFNVNQGDASANAGITGDAARATAGTDAIGGRFDAKWGSNAGAYASTNDMNVSG
YQATKEDGATAIDQRNAENLKPVIEASTSNSGAIDNRSSQAAYDTLAERGEAARQGSNLGKVVAEGANSA
FTGIDTIARAFRSSSDSEKLDNYYDIGISQGLKPEEAQYFAAKATGEFGESQGDAYRELNSYYRSQGIRD
DNYIAGAITAIDDAAKAPESGSYPTLTALADSRDAVQYQRDAVQPAPNEDVPQLPTQAQTAQPLTEVPGS
RDAVQPALNEDVPQLPTQAQTAQPLTEVPGSRDAVQPAPNEDVPQVPTQAPAPQPARSVPPPAPSPSSAE
PTNLKPQRPTGINAD
 
Nucleotide Sequence: 3408 bp     [Download]
>gi|296100168|ref|NC_014124.1|:64858-68265 Pseudomonas putida plasmid pDK1, complete sequence
ATGGACTTCACTATCTACACGACAGGCAGCGCCGAGTTCCTTGAGATCATGCTCAATGCCTGCGCAATGA
TCACAGGCAGCGGTGACGCAGAAGATCTTGCCCGTATTGGCGCGCTGATAGGTCTCTTTCTGTTGGCTTT
CCAAGCAGTTTTTAATAACCAGGCCATTACCTTCGGAAAGGCGGGCCTTGTGCTCGTCCTTTACATGATG
TTCTACGGTCCTACAGCCACCACTGTTATCGAGGATACGGTGTCGTCGCAGGTGCGGGTGGTGGACAACG
TGCCTCTTGGCCCTGCCTTTGTCGGCTCAGTCATCTCAACGGTGGCCTACGGCATTACAAAAACCGCGGA
GCAGGCATTTTCTACTCCAAGCATGACTGACTACGGGCTGTTCTCGAGCCTGAGCACATTGTCGAAAGTG
CGCGACGCTCTTCGGAACCCGATGGCACTGGACGGCTTCCAAAACTACCGAAAAGCGGACGGGTGGGATC
TGCCCCGATCGGTGAACGAGTACATGACATTCTGTTCACTGAACCCCGTGGCGCTGAGAACGGATAAGAC
CTTGACCGACTTGTACCGATCGCCTGGCTGGGCGGAGGTGCTGTCAAACCAGAACTCATCGATGTTCATC
TACGTCTATGACGGTACCGCCGGCACCATGAAAAGCTGTGCAGAGGCGCGGTCGTTTCTCAACGCCCATT
TGCAGAACGTCTATACAGACGTGCTAGAGGACATTCTCCAGAAAGGGTTCAGCGAAGAGGCCAAGACCAA
CCGCATGACCAGCGGTATCCAGGTTCAAGCCGCTACTGACCAAGCTATTCAGAGCCTCGCACTGAGTAGC
AAGTCGGCTCAGGACTACGTTTTGACTTCGCTAATTGCGCCGATTTTCAACGATTCCCGTGTCGATGCCA
TGAACCATTGGCAAGAGCAAAGAGCCGCAATGGCTCTTCGCGAATCGCTCAACCAGCAAGAAATTCAATG
GGCGGGGAAGGGCGACAGCTTCAAACACTACATGAGACCGATGATCGCCTTCTTCGAGGGCATGCTCTAT
GCGATGACGCCGTTCATGGCCTTTGCTTTGCTCCTGGGTGGGCCTGGCCTTTCTATCCTTGGCAAGTATC
TCGTGTTGCCGCTGGCGGTGGGTTTGTGGATGCCGCTGTTGAGTATCGTGAATGCTTTTACCCTCTGGTA
TGCAGGCTCCCAGATGGAAGCCGTATTCAACGGCTACGACCCCACAGGTTCTGGTTTTGCAATGCTCCAA
CTCATGGACATAGACAAAGCCATCGGCAAGGCACTGGGTATTGGCGGTCTGCTTGCGGCGTCCGTGCCTC
CATTGGCACTGTTCATCGTTTCCGGCTCTGCCATGGTTGCCAACAGCGTCATGAGCCAAATGACGGCAGG
CGACAAATTCAAGTCCGAAGACGTTACTCCTCGATCTCAGGAGAGCGCACCTGTCCTAAGCACCAATGCT
TCGTTCACATCTGACCAGGTAAGCGCGGGCGTTGCTAAAACAGGCACTCCGCAACTTGCAGAAACCATCA
GCAGCGAGCAGGCCGCTAGTGCGGTCGTGCAGAGCGCAAATATGGCCTCCCAAACTGCAACCTCGCAGTA
CCAGGAAAGTCTCAAGGCAGCCGGGCAACAACTCAACTCGTCTGCCACAGGACGGCAAGCACTTGCGCAG
ATCGGGGAAAACCTTTCGGCAGGATCGGTCCTCAGCTCGAATGCATCTTACAACGAGGCAAAAGAGTCCC
TGCGCAGCCTCGGCTTCTCCGAGTCGTCGCTGAATCAGGCCACGTCCAACGCCGCGATGGGCATTTCTAC
GCCACTTGGCGGCATGAAGCGGTCGGACAACACCTCGGCCGACACCATGACTCAGGAAAGCAGAGCCAAG
GCGGAGAAAGCACTCGCGCAACTTACGCAGTCTGTCCAGGCAACCGATTCGAGCACGTTGACCTTTGCGA
CGGGCGATGCCTTCTCCAGTAGCGCGTTGGCACAGCAGAGCGCATCGAACACAGACGAGATCGGGAAAAC
CCGTTCGAGTGCCCTTCAGGCGCAACAGACCTATAGCCAGGCATCTGCTCAACAAGATTCGATCAAGGCA
GGTCAATCACTCAACCTTAGAGACGCCGGCGTCAAAGCGCTCACCCGCGGGCTCGGCCGCAATGAAACTG
CGCTGGCGCTTGAGAAAATGGCAGGACAAACAGAGTCAGGCAAAGATCTGTACAAACAAGCCTTTGGTAG
CCAAAGCATCCAAGACATGTCGAAAGACACGAGCGAGCGTCGTGCTATGGCAGCTATTCGTGCGATCAAC
CAGGATGGACGCCTTGGTGAGCTGTTGATGAGCCCATACAACCCCTTCGACTTCAACGTCAACCAAGGCG
ATGCCAGCGCGAACGCCGGTATCACCGGTGACGCTGCGAGGGCTACGGCTGGCACAGATGCCATTGGCGG
CAGGTTCGATGCGAAGTGGGGCTCCAATGCAGGTGCTTACGCGAGCACGAACGACATGAACGTCAGCGGT
TATCAGGCTACGAAGGAAGATGGGGCTACGGCCATTGATCAGCGCAATGCTGAGAACCTGAAGCCCGTGA
TAGAGGCAAGCACGTCGAATTCGGGAGCCATTGATAACCGTTCATCCCAAGCGGCCTATGACACCCTGGC
GGAGCGAGGCGAAGCCGCAAGACAAGGCTCCAATCTAGGCAAGGTAGTGGCCGAAGGTGCCAACTCGGCG
TTTACAGGTATCGATACGATTGCTCGAGCGTTCCGCAGCAGCTCAGATAGTGAAAAGCTCGACAACTACT
ATGACATTGGTATCAGTCAAGGGCTGAAGCCAGAGGAGGCGCAATACTTTGCTGCCAAAGCAACTGGTGA
GTTCGGCGAGTCCCAAGGGGATGCTTATCGTGAGCTGAATAGCTACTACCGCAGCCAAGGCATCCGGGAT
GACAACTACATCGCCGGGGCTATTACTGCGATTGATGATGCTGCCAAGGCCCCTGAAAGCGGCTCCTATC
CCACCCTGACGGCGCTCGCGGACTCAAGGGATGCTGTGCAGTATCAAAGGGATGCCGTGCAGCCCGCGCC
GAATGAGGATGTTCCTCAGCTACCGACACAGGCTCAAACCGCTCAACCGCTGACCGAGGTGCCGGGCTCA
AGGGATGCCGTGCAGCCCGCGCTGAACGAGGATGTTCCTCAGCTACCGACACAGGCTCAAACCGCTCAAC
CGCTGACCGAGGTGCCGGGCTCAAGGGATGCCGTGCAGCCCGCGCCGAACGAGGATGTTCCTCAAGTTCC
AACCCAGGCTCCGGCCCCACAACCAGCCAGATCTGTTCCACCACCTGCTCCATCACCATCCTCGGCGGAA
CCCACCAACCTCAAACCTCAGCGACCGACAGGGATCAATGCTGACTAG
 Primer design