SecReT4
Protein ID: 296100239
T4SS name [ID]Tra_F [579]
Gene symbol-
Locus tagpDK1_p071
StrainPseudomonas putida plasmid pDK1 (NC_014124)
Repliconplasmid pDK1 [GenBank: NC_014124] [Browse all T4SS(s) in this replicon]
Location [Strand]69853..70422 [-]
Productlytic transglycosylase
Component typeOrf169_F
UniProt IDD5MPD8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 189 a.a.     [Download]
>gi|296100239|ref|YP_003617156.1| lytic transglycosylase [Pseudomonas putida]
MFNIRISSFIAVSACIAIGTSVSAKANGFSLKGTMWERASMASACKPDPLLLYSLALKESKTSAGKGMIA
PHPFALRNEPSGALYPNTYMDAKAVLGKYIAEDILTDIGIMQINYRWNGNRVARPEFLLDPEVNIRVGAQ
ILCESIAQYPVDMQLAIGGYHTRNPKRELDAREYASNVLSIWRSLQRLK
 
Nucleotide Sequence: 570 bp     [Download]
>gi|296100168|ref|NC_014124.1|:c70422-69853 Pseudomonas putida plasmid pDK1, complete sequence
ATGTTTAATATCCGTATCAGCTCTTTTATTGCAGTATCTGCATGCATTGCCATAGGTACTTCAGTGAGCG
CTAAAGCTAATGGCTTTTCATTAAAAGGAACGATGTGGGAGCGAGCGTCAATGGCCTCCGCATGCAAGCC
GGACCCTCTGCTTCTATATTCACTAGCTCTAAAGGAATCTAAAACATCTGCCGGAAAAGGCATGATTGCA
CCACACCCGTTTGCGCTTCGCAATGAACCTAGTGGCGCTCTGTACCCTAATACCTACATGGATGCCAAGG
CTGTACTCGGCAAATATATTGCCGAAGACATCCTCACCGACATAGGGATTATGCAAATAAACTATCGTTG
GAACGGCAATAGAGTAGCGCGCCCGGAGTTTCTTCTTGACCCCGAGGTGAACATCCGCGTTGGTGCTCAG
ATACTTTGCGAGTCGATTGCTCAATATCCTGTCGATATGCAACTTGCTATTGGTGGGTACCATACACGAA
ACCCAAAGCGTGAACTTGACGCACGCGAGTATGCGAGTAATGTGCTCAGCATTTGGCGTTCACTACAGCG
TTTAAAGTAA
 Primer design