SecReT4
Protein ID: 296100783
T4SS name [ID]Tfc [720]
Gene symbol-
Locus tagECL_00414
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T4SS(s) in this replicon]
Location [Strand]429428..430714 [+]
Productpilus biogenesis protein PilL
Component typeTfc2
UniProt IDD5CDL7
KEGG IDenc:ECL_00414
PDB IDNA
Domain hit(s) vs Pfam TcpQ [PF10671], Evalue: 3.9e-23, Aligned region: 337..423
Protein Sequence: 428 a.a.     [Download]
>gi|296100783|ref|YP_003610929.1| pilus biogenesis protein PilL [Enterobacter cloacae subsp. cloacae ATCC 13047]
MAVPSRRVATGAALLACSVIQAGCSSAVSDPAPFANGRYQQPTRFDDIYRNRAPDVVRYDRYTLVSTRPD
DAQRDPLNQIVDITMPAQLVKTVGEGFRYLLLESGYSLCSATTSAFSELLSRPLPAVQRDIGPVRLSEAL
QIVAGPAWRLKVDDVNREICFELRDQYRSFAAPLPAPVSLVSQHAPVSLPPVIQPARTGGAAGTVNAVPR
NPFTGDTSINSTPGTLQKPVLTAQNQSVPSPVLTVAKTPAAQKSAALSPAGRPPVPPPAAAPKAASSQKT
PVTAVHPVTVQPATVNAARQTVPVRPVTSLPPAPPVSGQTASSYIPGAPVTPQPVGQTWRAEPGSTLKET
LTGWASKATCSNGGNWVVIWPVSLDYRIDAPLVFHGNFESVLVQVFDLYRKAEKPLFAEANRIQCLISVS
DTPTGGGH
 
Nucleotide Sequence: 1287 bp     [Download]
>gi|296100371|ref|NC_014121.1|:429428-430714 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGGCAGTACCTTCCAGACGTGTGGCAACGGGCGCTGCCCTCCTCGCCTGTTCAGTTATACAGGCGGGCT
GCAGCAGCGCCGTTTCTGATCCCGCGCCCTTTGCAAACGGCCGCTATCAGCAGCCCACCCGCTTCGATGA
TATTTACCGCAACCGGGCCCCCGACGTGGTTCGCTATGACCGTTATACGCTGGTCAGCACGCGCCCGGAC
GATGCACAGCGCGATCCACTCAATCAGATTGTCGATATCACCATGCCGGCGCAACTGGTCAAAACGGTCG
GTGAGGGCTTTCGCTATCTGCTGCTGGAGTCCGGATATTCACTGTGCTCAGCCACAACCTCCGCATTTTC
AGAACTTCTTAGCCGTCCACTGCCGGCCGTTCAGCGTGATATCGGTCCGGTCCGGCTCAGTGAAGCCCTG
CAGATTGTGGCCGGCCCGGCCTGGCGACTGAAGGTGGATGACGTTAACCGTGAAATTTGCTTTGAACTGC
GGGACCAGTATCGCAGCTTCGCCGCACCGTTGCCGGCTCCGGTCTCACTGGTGTCACAGCATGCACCCGT
CAGTCTCCCCCCGGTCATACAGCCAGCCCGGACTGGCGGGGCCGCCGGCACTGTCAATGCTGTGCCGCGT
AATCCCTTTACCGGTGATACGAGTATCAACAGCACCCCGGGGACCCTGCAAAAACCGGTACTTACGGCGC
AGAACCAGTCCGTCCCGTCACCGGTACTGACAGTGGCGAAGACACCTGCAGCACAGAAGTCTGCTGCGCT
GTCGCCAGCCGGGCGCCCGCCGGTGCCACCACCTGCAGCTGCACCGAAAGCGGCCTCATCTCAGAAAACC
CCTGTTACAGCCGTTCATCCGGTTACCGTACAGCCAGCTACAGTGAACGCTGCCCGGCAGACTGTGCCCG
TCCGGCCCGTCACCTCACTGCCGCCGGCTCCCCCCGTCTCCGGTCAGACCGCTTCTTCATATATACCGGG
GGCGCCGGTCACTCCTCAGCCAGTTGGCCAGACGTGGCGTGCCGAACCGGGTTCCACACTGAAAGAGACC
CTGACGGGCTGGGCATCAAAGGCGACGTGCAGCAATGGCGGAAACTGGGTGGTCATCTGGCCGGTATCAC
TGGATTACCGCATTGATGCGCCTCTGGTGTTTCACGGCAACTTCGAATCCGTCCTGGTACAGGTCTTTGA
TCTCTACCGCAAAGCGGAAAAACCGCTGTTTGCCGAGGCTAACCGCATTCAGTGCCTGATTTCGGTGAGC
GATACCCCGACGGGCGGAGGGCACTGA
 Primer design