SecReT4
Protein ID: 296100797
T4SS name [ID]Tfc [720]
Gene symbol-
Locus tagECL_00428
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T4SS(s) in this replicon]
Location [Strand]443566..444279 [+]
Producthypothetical protein
Component typeTfc3
UniProt IDD5CDN1
KEGG IDenc:ECL_00428
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 237 a.a.     [Download]
>gi|296100797|ref|YP_003610943.1| hypothetical protein ECL_00428 [Enterobacter cloacae subsp. cloacae ATCC 13047]
MKKTLMASLFLVPLMTSAATVRTSSAQSSISTSQESSTGVLSAQQQAQQWGLSDSDWSRYQTLMEGDRGI
MSPGLDPLTALGVETDNSAERRRLAELWVRHEYQRSEKELAFQREINAAWLRLYPETLAVNMGSNAAGIA
HDTQGRLALFVKENCSRCDARLAAVLADDRPVDIYLVGGNSDEAIRTWAIRHNIPVEKVRSRQITLNHDG
GLWLRYGQGQMPVILQQGENGWQLAAF
 
Nucleotide Sequence: 714 bp     [Download]
>gi|296100371|ref|NC_014121.1|:443566-444279 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGAAAAAAACACTGATGGCCTCACTGTTTCTGGTGCCGCTCATGACCTCCGCTGCCACGGTCAGGACAT
CCTCCGCGCAGAGCAGCATATCCACATCGCAGGAGTCCTCCACCGGCGTGCTGAGTGCGCAGCAGCAGGC
GCAGCAGTGGGGACTGTCTGACAGCGACTGGAGCCGTTATCAGACCCTGATGGAGGGGGATCGCGGCATT
ATGTCACCGGGCCTTGACCCGCTGACGGCGCTGGGTGTGGAAACCGATAACAGTGCTGAACGCCGTCGCC
TGGCTGAACTCTGGGTGAGGCACGAATACCAGCGAAGCGAAAAGGAGCTGGCCTTTCAGCGCGAAATCAA
TGCTGCCTGGCTGCGACTGTATCCGGAGACGCTGGCCGTCAACATGGGCAGCAATGCGGCGGGTATCGCG
CACGACACACAGGGGCGTCTCGCCCTGTTTGTGAAAGAGAACTGCTCGCGTTGCGATGCGCGTCTGGCGG
CCGTGCTCGCCGACGACCGTCCCGTCGATATTTATCTGGTCGGCGGAAACAGCGATGAGGCCATCCGTAC
CTGGGCCATCCGTCACAACATCCCGGTGGAAAAAGTCCGCAGCCGCCAGATAACGCTCAACCACGACGGT
GGCCTGTGGCTGCGCTACGGGCAGGGCCAGATGCCGGTGATTCTGCAGCAGGGGGAAAACGGATGGCAGC
TCGCCGCATTCTGA
 Primer design