SecReT4
Protein ID: 296100798
T4SS name [ID]Tfc [720]
Gene symbol-
Locus tagECL_00429
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T4SS(s) in this replicon]
Location [Strand]444258..444869 [+]
Producthypothetical protein
Component typeTfc4
UniProt IDD5CDN2
KEGG IDenc:ECL_00429
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 203 a.a.     [Download]
>gi|296100798|ref|YP_003610944.1| hypothetical protein ECL_00429 [Enterobacter cloacae subsp. cloacae ATCC 13047]
MAARRILMLGAGILFATAASGATDLQVIPDAYRQIAAAERVPAESLYSLAMAESTRKTAWGAKPWPWTIN
VAGRGYHYSTREEAFTALLGFMQRWPLKNIDVGVAQVNLGWNGHFFPTYRDAFDPYTNLRAAARILRACY
DARPGSWLRAAGCYHHPSGGAHAATYMAIVRRKLSQIAMTGTPAAVGQPGLLARNSLSWIEPQ
 
Nucleotide Sequence: 612 bp     [Download]
>gi|296100371|ref|NC_014121.1|:444258-444869 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGGCAGCTCGCCGCATTCTGATGCTGGGTGCCGGGATTCTGTTTGCAACAGCGGCGTCCGGCGCCACAG
ACCTGCAGGTTATTCCTGATGCGTACCGGCAGATAGCCGCCGCTGAGCGGGTGCCGGCGGAGTCACTGTA
TTCGCTGGCAATGGCCGAAAGCACCCGCAAAACTGCCTGGGGTGCGAAGCCGTGGCCGTGGACCATTAAC
GTCGCAGGCAGGGGTTACCATTACAGCACGCGTGAAGAGGCCTTCACGGCGCTGCTCGGGTTTATGCAGC
GCTGGCCGCTGAAAAATATTGATGTCGGTGTGGCCCAGGTGAACCTGGGCTGGAACGGGCATTTTTTCCC
GACATACCGTGATGCGTTTGATCCGTACACCAATCTTCGCGCAGCGGCCCGTATCCTGCGGGCCTGCTAT
GACGCCCGCCCCGGCAGCTGGCTTCGTGCGGCGGGCTGCTACCACCATCCGTCAGGCGGTGCGCACGCGG
CAACCTATATGGCCATTGTGCGACGCAAGCTCAGTCAGATAGCCATGACCGGTACACCGGCGGCCGTCGG
TCAGCCCGGGTTACTGGCCCGAAATTCTCTTTCCTGGATTGAACCGCAATGA
 Primer design