SecReT4
Protein ID: 296100799
T4SS name [ID]Tfc [720]
Gene symbol-
Locus tagECL_00430
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T4SS(s) in this replicon]
Location [Strand]444866..445396 [+]
Producthypothetical protein
Component typeTfc5
UniProt IDD5CDN3
KEGG IDenc:ECL_00430
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 8.3e-46, Aligned region: 31..175
Protein Sequence: 176 a.a.     [Download]
>gi|296100799|ref|YP_003610945.1| hypothetical protein ECL_00430 [Enterobacter cloacae subsp. cloacae ATCC 13047]
MKNTLRYTLVFTLFSGLLTSAFSASATLTVVGDLGGESTGPLFDAINAGPGQSATESPVLPPPPASLSLS
DMLPVSTPEMSPGAVAARPLNLPGMPPVFVLGDDASSRHWLTHHATTLSRMQATGMVISVRDEQGLNALR
QLAPGVAMVPVSGGDLARRLALTHYPALITATGISQ
 
Nucleotide Sequence: 531 bp     [Download]
>gi|296100371|ref|NC_014121.1|:444866-445396 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGAAAAATACGCTTCGTTATACCCTTGTTTTCACGCTTTTTTCAGGGCTGCTGACCAGTGCCTTTAGTG
CCTCTGCCACGCTGACCGTGGTGGGCGACCTCGGCGGTGAATCCACAGGACCGCTGTTTGACGCCATCAA
TGCCGGTCCGGGTCAGTCTGCAACGGAGTCGCCCGTTCTCCCGCCACCGCCGGCATCGCTTTCCCTGTCC
GACATGCTGCCGGTCAGCACGCCTGAAATGTCACCAGGCGCTGTCGCCGCCCGGCCGCTGAATCTTCCCG
GCATGCCGCCGGTGTTTGTACTGGGTGACGATGCGTCTTCCCGTCATTGGCTCACGCACCACGCCACCAC
GCTCAGCCGCATGCAGGCAACCGGCATGGTTATCAGTGTCAGGGATGAGCAGGGATTAAACGCACTGCGT
CAGCTGGCGCCGGGGGTGGCAATGGTGCCTGTCAGCGGCGGTGACCTGGCCCGTCGCCTGGCACTGACGC
ATTATCCTGCCCTCATCACCGCAACGGGGATATCACAGTGA
 Primer design