SecReT4
Protein ID: 296100803
T4SS name [ID]Tfc [720]
Gene symbol-
Locus tagECL_00434
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T4SS(s) in this replicon]
Location [Strand]447206..449323 [+]
ProductTraG-family protein
Component typeTfc6
UniProt IDD5CDN7
KEGG IDenc:ECL_00434
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 1.7e-15, Aligned region: 510..638
TrwB_AAD_bind [PF10412], Evalue: 1.5e-11, Aligned region: 507..648
AAA_10 [PF12846], Evalue: 6.7e-09, Aligned region: 496..585
Protein Sequence: 705 a.a.     [Download]
>gi|296100803|ref|YP_003610949.1| TraG-family protein [Enterobacter cloacae subsp. cloacae ATCC 13047]
MSDRYVMESLLRPAVELYSATVAASATCICLTAPWAVALSPSVSWVTAAGFGVLALKRTREGMKILRYRQ
NIRRLPRYVLTSEQIPVSRRHLFLGKGFQWSVRHTQRLIEARRPECEIYVQPSVLYRMAREMEKKMEYSL
PWLCRLTCTDSALNPFRPLPPVGGSPVYHGVEPDETTVTYDLGERVGHMLVIGTTRVGKTRLAELLITQD
IRRTNAAGEHEVVIVFDPKGDADLLRRMYAESHRAGRQDNFWVFHLGWPDISARYNAVGRFSRISEVASR
VAGQLSGEGNSAAFREFAWRFVNIITRALVALGQRPDYGLILRYVTNIGELYETYVDNLLSEKAPQLMNT
TEAMMQSGISDKDLPRHLQGRPNGVKIWVSEQVLGSPEGKKLWDPVLDGLRSAVQYDRTYFDKIVASLLP
LLEKLTTGKTAALLAPDYTDLDDPRPILDWHNIIKSRGVVYVGLDALSDPVVAAAVGNSMFADLVSEGGH
IYKFGLGDEEEGKSAKVAINLHCDEFNELMGDEFIPLINKGGGAGFQVTAYTQTLSDIEARIGSTAKANQ
VVGNFNTLVMLRVREKNTAMLLTDQLPEVDVYQKTLTSGVTDVSRPGEGTDFNSNVNDQVSLVKVPMIRP
ADIINLPKGQAFALLEGGRLWKIRMPLPADNNDPHMPASLKHLADSMEKNYHTGETWWTGGDITYAGGPD
ATAGQ
 
Nucleotide Sequence: 2118 bp     [Download]
>gi|296100371|ref|NC_014121.1|:447206-449323 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGAGCGATCGCTATGTGATGGAATCCCTGCTGCGCCCGGCTGTGGAACTGTATTCCGCAACGGTTGCGG
CCAGTGCGACCTGTATCTGCCTGACCGCCCCGTGGGCGGTGGCACTCTCGCCTTCTGTCAGTTGGGTGAC
GGCCGCCGGTTTCGGCGTTCTGGCCCTGAAGCGCACCCGCGAGGGCATGAAAATTCTGCGCTACCGGCAG
AATATCCGCCGTCTTCCCCGTTATGTACTGACCAGCGAACAGATACCGGTCAGCCGGCGCCATCTGTTTC
TGGGGAAAGGTTTTCAGTGGTCTGTGCGTCATACCCAGCGGCTGATTGAGGCGCGTCGGCCGGAGTGCGA
AATCTATGTGCAGCCCTCCGTGCTGTACCGCATGGCGCGTGAGATGGAAAAGAAGATGGAGTACAGCCTC
CCCTGGCTGTGCCGGCTGACCTGCACGGATTCGGCGCTGAACCCTTTTCGCCCTTTACCCCCGGTCGGCG
GCAGCCCGGTGTATCACGGTGTCGAGCCTGATGAGACTACGGTGACCTACGATCTCGGCGAACGCGTCGG
GCATATGCTCGTTATCGGCACGACCCGCGTGGGCAAGACCCGACTGGCGGAACTGCTTATCACCCAGGAT
ATCCGCCGCACAAACGCCGCCGGTGAACACGAGGTGGTCATTGTGTTTGACCCTAAAGGGGACGCGGACC
TGCTCCGGCGGATGTACGCAGAGTCGCACCGCGCGGGGCGTCAGGATAACTTCTGGGTGTTCCACCTCGG
CTGGCCCGATATCAGCGCCCGGTATAACGCCGTCGGACGGTTCAGCCGTATCTCCGAGGTGGCCTCCCGC
GTGGCCGGTCAGCTCTCGGGGGAAGGTAACTCCGCGGCCTTCCGTGAATTTGCCTGGCGGTTCGTCAATA
TCATCACCCGCGCGCTGGTCGCCCTCGGACAACGCCCGGACTACGGCCTCATTCTGCGGTATGTCACCAA
TATCGGTGAGCTGTATGAGACTTACGTGGATAACTTGCTGAGCGAAAAGGCGCCGCAGCTGATGAATACA
ACGGAAGCCATGATGCAGAGCGGGATCAGCGATAAGGACCTGCCGCGTCATCTCCAGGGACGGCCTAACG
GCGTGAAAATCTGGGTGTCAGAGCAGGTGCTCGGCAGCCCGGAGGGGAAAAAACTCTGGGACCCGGTGCT
GGACGGCCTGCGCAGCGCGGTGCAGTACGATCGCACCTACTTCGATAAAATTGTGGCATCCCTGTTACCA
CTACTGGAGAAACTCACTACCGGCAAAACGGCCGCGCTTCTCGCCCCAGACTACACCGACCTGGACGATC
CGCGTCCGATTCTCGACTGGCACAATATCATCAAGTCCCGAGGCGTGGTATACGTGGGCCTCGATGCACT
CTCCGACCCGGTGGTGGCCGCCGCCGTTGGAAACAGCATGTTCGCAGACCTCGTGTCTGAGGGAGGCCAC
ATCTATAAGTTCGGTCTCGGTGATGAGGAAGAGGGGAAATCCGCAAAGGTGGCCATCAACCTTCACTGCG
ATGAGTTTAACGAGCTGATGGGGGATGAATTTATCCCGCTTATTAACAAAGGCGGTGGTGCCGGTTTTCA
GGTGACGGCTTACACCCAGACGCTTTCTGACATCGAGGCCCGCATCGGCAGTACGGCCAAAGCGAACCAG
GTGGTGGGTAACTTCAACACTCTGGTGATGCTGCGCGTGCGCGAGAAAAACACCGCCATGCTGCTCACCG
ATCAGCTCCCGGAAGTGGATGTCTACCAGAAAACACTGACATCGGGTGTCACCGACGTCTCGCGTCCCGG
GGAAGGCACGGATTTTAACAGCAACGTTAACGACCAGGTGAGTCTGGTAAAAGTGCCGATGATAAGACCT
GCTGACATCATCAATCTGCCGAAAGGCCAGGCCTTTGCACTGCTGGAAGGGGGAAGACTGTGGAAAATCC
GTATGCCGTTGCCGGCGGATAACAACGACCCACATATGCCGGCCAGCCTGAAGCATCTGGCTGACAGCAT
GGAGAAAAACTACCACACCGGTGAAACCTGGTGGACCGGTGGTGACATAACGTATGCAGGAGGGCCGGAT
GCCACAGCAGGACAGTGA
 Primer design