SecReT4
Protein ID: 296100804
T4SS name [ID]Tfc [720]
Gene symbol-
Locus tagECL_00435
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T4SS(s) in this replicon]
Location [Strand]449304..450065 [+]
Productputative inner membrane protein
Component typeTfc8
UniProt IDD5CDN8
KEGG IDenc:ECL_00435
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 1.5e-67, Aligned region: 51..250
Protein Sequence: 253 a.a.     [Download]
>gi|296100804|ref|YP_003610950.1| putative inner membrane protein [Enterobacter cloacae subsp. cloacae ATCC 13047]
MPQQDSENGQRSATPRQRQSGPIGLLLWDFPMGLIGVLLGSLLVSLLIEYVCIALLWPEEGAAHSYQVMV
AESHWLSEGYTRSLLMAAPVETVSRWVHVAWQWLFVDSGFSGWLQSFKSLSEKGSGLIPALNGIGATLVS
WLGVYLQATVWVTLIFFIRVMILFLSLPLFALVVITGVVDGLVRRDLRRYGAGYESSFVYHHAKRFIKPA
LYGPCMLYLAWPTAVWPNLLLLPSALLVGGVLAVVTGSFKKYL
 
Nucleotide Sequence: 762 bp     [Download]
>gi|296100371|ref|NC_014121.1|:449304-450065 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGCCACAGCAGGACAGTGAGAACGGGCAGCGCAGCGCGACGCCCCGACAGCGACAGTCCGGTCCGATTG
GCCTGCTGCTCTGGGATTTCCCGATGGGCCTTATCGGTGTGTTGCTCGGTTCACTCCTGGTCAGCCTGCT
TATCGAGTATGTCTGTATTGCGCTGTTGTGGCCGGAAGAAGGCGCGGCCCACAGCTATCAGGTGATGGTG
GCAGAAAGCCACTGGCTCTCGGAAGGGTATACGCGCAGTCTGCTGATGGCCGCCCCGGTTGAGACAGTCA
GCCGGTGGGTGCACGTTGCCTGGCAGTGGCTGTTTGTGGATAGCGGGTTCAGTGGCTGGCTGCAGTCATT
TAAATCCCTGAGCGAAAAAGGTAGCGGGCTTATTCCGGCGCTGAACGGAATCGGAGCCACGCTTGTGAGC
TGGCTGGGTGTGTACCTTCAGGCCACGGTCTGGGTCACGCTGATATTCTTCATCCGGGTAATGATCCTGT
TTCTCAGCCTGCCGCTGTTCGCGCTGGTTGTCATCACGGGCGTGGTGGACGGGCTGGTCAGACGTGACCT
GCGTCGCTACGGCGCGGGGTATGAATCGAGCTTTGTGTATCACCATGCCAAACGCTTTATCAAACCCGCC
CTGTATGGCCCCTGCATGCTCTATCTGGCCTGGCCAACTGCGGTGTGGCCGAATCTGCTGTTGCTGCCAT
CAGCCTTGCTGGTCGGTGGTGTGCTCGCCGTGGTGACCGGCTCGTTCAAAAAATACCTCTAG
 Primer design