SecReT4
Protein ID: 296100805
T4SS name [ID]Tfc [720]
Gene symbol-
Locus tagECL_00436
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T4SS(s) in this replicon]
Location [Strand]450271..450588 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDD5CDN9
KEGG IDenc:ECL_00436
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 1.8e-29, Aligned region: 20..97
Protein Sequence: 105 a.a.     [Download]
>gi|296100805|ref|YP_003610951.1| hypothetical protein ECL_00436 [Enterobacter cloacae subsp. cloacae ATCC 13047]
MPHTRILTALLMAVLPALQCHASEKDELALVMRQLDQVQAGLDRARVVANQTQDARFYFDYQQATRDITT
MKQGISTYLEPSRAQPASPSSSVTGQYRAQAPAWR
 
Nucleotide Sequence: 318 bp     [Download]
>gi|296100371|ref|NC_014121.1|:450271-450588 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGCCTCATACCCGAATCCTCACAGCCCTGCTGATGGCCGTCCTGCCCGCGCTGCAGTGCCACGCTTCAG
AGAAAGATGAACTCGCGCTGGTCATGCGCCAGCTCGACCAGGTGCAGGCCGGGCTGGACCGCGCCCGCGT
GGTGGCGAACCAGACCCAGGATGCCCGCTTTTACTTCGATTATCAGCAGGCGACGCGCGATATCACCACC
ATGAAGCAGGGGATCTCAACCTATCTTGAACCCTCCCGCGCGCAGCCTGCGTCACCGTCGTCTTCTGTCA
CCGGACAGTACCGCGCACAGGCACCGGCATGGCGATGA
 Primer design