SecReT4
Protein ID: 296100808
T4SS name [ID]Tfc [720]
Gene symbol-
Locus tagECL_00439
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T4SS(s) in this replicon]
Location [Strand]451213..451587 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDD5CDP2
KEGG IDenc:ECL_00439
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 2.2e-34, Aligned region: 3..116
Protein Sequence: 124 a.a.     [Download]
>gi|296100808|ref|YP_003610954.1| hypothetical protein ECL_00439 [Enterobacter cloacae subsp. cloacae ATCC 13047]
MAVIDFLPDRLNNPPVVWKGFTSGEFLLAAITGVIAGIPLAVPLALVPFIGWLAFPTCMLLMPMFVIFFG
GGWIAGYKRGKPENYIWQRLEEIRCRTGLSRALILNSRAWEMKRTTAIKRGGLS
 
Nucleotide Sequence: 375 bp     [Download]
>gi|296100371|ref|NC_014121.1|:451213-451587 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGGCCGTCATCGATTTCCTTCCTGACCGTCTGAACAACCCGCCTGTGGTGTGGAAAGGTTTCACGTCCG
GTGAATTTCTTCTGGCGGCCATCACCGGCGTCATTGCCGGTATTCCGCTGGCGGTGCCGCTGGCTCTGGT
ACCTTTTATCGGCTGGCTGGCCTTTCCCACCTGTATGCTGCTGATGCCGATGTTCGTCATCTTCTTCGGC
GGGGGCTGGATTGCGGGTTACAAGCGCGGTAAGCCGGAGAATTATATCTGGCAACGCCTGGAGGAAATCC
GCTGTCGTACCGGTCTGTCCCGTGCCCTGATCCTCAACAGCCGGGCATGGGAGATGAAACGTACCACAGC
GATAAAACGCGGAGGTCTGTCATGA
 Primer design