SecReT4
Protein ID: 296100809
T4SS name [ID]Tfc [720]
Gene symbol-
Locus tagECL_00440
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T4SS(s) in this replicon]
Location [Strand]451584..452228 [+]
Producthypothetical protein
Component typeTfc12
UniProt IDD5CDP3
KEGG IDenc:ECL_00440
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 9e-91, Aligned region: 8..203
Protein Sequence: 214 a.a.     [Download]
>gi|296100809|ref|YP_003610955.1| hypothetical protein ECL_00440 [Enterobacter cloacae subsp. cloacae ATCC 13047]
MSRFRNGMTARDNHIFSLRIACALLFAGMLMAGIGWMRAPSELTIHNPPDLRSGSTRKWWEVPPSTVYSF
AFYIFQQLNSWPKNGEVDYPAKIAQMSPYLTPSCQDFLNKDAEMRKNSDELRDRVRVVYEIPRRGYSSRS
VTILDQDHWIAQLDLVADEYYHTEPVKRALVRYPLKVVRWEGDPERNPFGLALDCYAATPQRLEAVTLPE
PEKK
 
Nucleotide Sequence: 645 bp     [Download]
>gi|296100371|ref|NC_014121.1|:451584-452228 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGAGTCGTTTCCGCAATGGCATGACCGCGCGGGATAATCATATTTTCTCCCTGCGCATCGCCTGTGCGC
TGCTGTTCGCTGGCATGCTGATGGCCGGTATTGGCTGGATGCGTGCACCGTCAGAACTTACCATCCACAA
TCCGCCGGATCTGCGTTCAGGCAGCACCCGTAAATGGTGGGAAGTGCCGCCTTCCACCGTGTACAGCTTT
GCCTTCTATATCTTTCAGCAGCTCAATTCCTGGCCAAAGAACGGCGAGGTGGATTATCCGGCAAAAATTG
CCCAGATGAGTCCTTACCTGACGCCGTCCTGCCAGGATTTTCTCAATAAAGACGCGGAGATGCGTAAAAA
CAGCGACGAGCTCCGGGACCGCGTGCGCGTGGTGTATGAGATCCCGCGCCGTGGCTACAGCAGCCGCAGC
GTCACCATTCTCGATCAGGACCACTGGATAGCACAGCTCGATCTGGTGGCGGATGAGTATTACCACACTG
AGCCGGTAAAACGTGCGCTGGTCCGCTATCCGCTGAAAGTGGTGCGCTGGGAGGGTGATCCGGAACGCAA
TCCCTTCGGACTTGCTCTGGACTGTTATGCGGCCACCCCGCAGCGGCTGGAGGCCGTCACGCTGCCTGAG
CCGGAGAAAAAGTGA
 Primer design