SecReT4
Protein ID: 296100810
T4SS name [ID]Tfc [720]
Gene symbol-
Locus tagECL_00441
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T4SS(s) in this replicon]
Location [Strand]452228..453136 [+]
Producthypothetical protein
Component typeTfc13
UniProt IDD5CDP4
KEGG IDenc:ECL_00441
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 2.8e-110, Aligned region: 6..296
Protein Sequence: 302 a.a.     [Download]
>gi|296100810|ref|YP_003610956.1| hypothetical protein ECL_00441 [Enterobacter cloacae subsp. cloacae ATCC 13047]
MKNPLKKCRLLLLAGLILSGAADAVELMKWERIPLQVPLTVGQERIVFVNKNVRVGFPPALNNKLRIQST
GGVVYLDASEAFPVTRLELQNKENGEIILLDVSAAPGKTTREPVKIVYDGEVATATASDRQSVSSEGDST
GRSAQQADTETTKPDRKPAKLNAPLPVVLTRYAAQNMYGPLRTVEPVPGISPVSLKLPSVITTLMPAEPV
TVTPMAAWSLQGSSVVALQVRNRSAGKVILDPRALEGQFTTATFQHRWLGRAGTPEDTTVLYLVTPGRPE
GAFIAEPPSLQPADGHKRRAKK
 
Nucleotide Sequence: 909 bp     [Download]
>gi|296100371|ref|NC_014121.1|:452228-453136 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGAAGAACCCGTTAAAAAAATGCCGTCTGCTCCTGCTCGCCGGACTGATCCTGTCGGGCGCGGCAGACG
CTGTGGAGCTGATGAAATGGGAACGTATCCCGCTGCAGGTTCCCCTGACGGTGGGTCAGGAGCGTATCGT
TTTTGTGAATAAAAACGTGCGTGTCGGCTTTCCACCCGCGCTTAACAATAAGCTGCGTATTCAGAGCACC
GGCGGCGTGGTGTATCTCGATGCGAGTGAGGCGTTTCCGGTGACGCGGCTTGAGCTGCAGAACAAGGAAA
ACGGGGAAATTATTCTGCTCGATGTATCAGCCGCACCGGGAAAAACCACGCGTGAACCCGTGAAAATTGT
CTATGACGGCGAAGTGGCCACCGCAACCGCCAGTGACAGGCAGTCCGTCAGCAGCGAGGGTGACAGCACC
GGCCGCAGTGCTCAACAGGCTGATACGGAAACCACAAAGCCGGACCGTAAGCCCGCGAAACTGAATGCAC
CGCTGCCGGTGGTCCTGACCCGCTATGCGGCCCAGAACATGTACGGTCCGTTGCGTACGGTTGAACCGGT
GCCGGGTATCAGCCCGGTGTCACTGAAGCTGCCTTCCGTCATCACCACACTGATGCCTGCTGAACCGGTC
ACCGTCACGCCGATGGCCGCCTGGAGTCTGCAGGGCAGCAGCGTCGTCGCGCTGCAGGTCCGTAACCGTT
CTGCCGGAAAGGTCATTCTTGATCCCCGCGCGCTGGAAGGTCAGTTTACCACGGCCACCTTCCAGCACCG
CTGGCTGGGGCGCGCAGGCACACCGGAGGATACAACGGTCCTCTATCTGGTGACGCCCGGACGCCCGGAG
GGTGCCTTCATTGCTGAGCCACCCTCGCTGCAGCCCGCTGACGGACATAAACGGAGAGCGAAAAAATGA
 Primer design