SecReT4
Protein ID: 296100811
T4SS name [ID]Tfc [720]
Gene symbol-
Locus tagECL_00442
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T4SS(s) in this replicon]
Location [Strand]453133..454656 [+]
Productputative secreted protein
Component typeTfc14
UniProt IDD5CDP5
KEGG IDenc:ECL_00442
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 507 a.a.     [Download]
>gi|296100811|ref|YP_003610957.1| putative secreted protein [Enterobacter cloacae subsp. cloacae ATCC 13047]
MKAPSSNLLVKVAVPVVLASAVVVGVKSCSGGGNQTAAPHTASNVALKDLSPEDLKALGIEGDTPQDTLR
TVVGNFRKVQDRLDTLADDNKKLSDENKALKTTNSNVDTQINQAVSNARAEEAQKRQQLSAEVTDLSTQV
KQLMDQLRNGGAGTESGKNSGSGSDIPIGLGYDSGLNSGAAGVSSSADGLHWVEPKDGVPVDASGRPVTD
SNKNNATGFSFATSFADTADAGKQAVGNTTAAVQTQLTDAQKATDPVYTLPENSTLVGSRAMTALLGRIP
VDGKVTDPYPFKVMIGKDNLTANGIELPDVQGAIVSGTATGDWTLSCVRGSITSITFVFSDGTVRTLPSP
DGQGQNGNSSNQNSQGGNSSSIGWLSDDNGIPCISGTRKSNASTYLPTIAALAAASAAGDAVAENQSTGQ
TNAYGGVTSTLTGNAGQAVLGKALSGGMRETVDWVKARYGQTFDAIYVPPGQTVALHITRQLAIDYEEKG
RRVKYDFSLAGSGTGMD
 
Nucleotide Sequence: 1524 bp     [Download]
>gi|296100371|ref|NC_014121.1|:453133-454656 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGAAGGCACCCTCCTCAAATCTTCTCGTGAAAGTCGCCGTTCCGGTGGTACTGGCCAGCGCGGTGGTGG
TGGGCGTGAAATCCTGCTCAGGGGGGGGGAATCAGACGGCTGCACCACATACCGCCAGCAATGTTGCGCT
GAAGGACCTGTCGCCGGAAGATCTCAAAGCGCTGGGTATTGAAGGTGACACGCCGCAGGACACACTGCGC
ACGGTGGTGGGAAATTTCCGCAAAGTGCAGGACCGTCTCGATACGCTCGCGGACGATAACAAAAAGCTCA
GCGACGAAAATAAAGCCCTGAAAACCACCAACAGCAATGTGGACACGCAGATTAATCAGGCAGTAAGCAA
TGCCCGTGCCGAGGAGGCGCAGAAACGCCAGCAGCTCAGTGCAGAGGTCACCGATCTCAGTACCCAGGTC
AAACAGCTGATGGATCAGTTGCGCAATGGCGGTGCCGGCACGGAATCCGGAAAAAACAGCGGCTCCGGCA
GTGATATTCCGATCGGGCTGGGCTATGACAGTGGGCTGAACAGCGGCGCCGCCGGCGTATCGTCTTCCGC
TGATGGACTTCATTGGGTGGAGCCAAAAGACGGTGTCCCCGTTGATGCCAGCGGCCGGCCGGTGACCGAC
AGCAACAAGAATAACGCCACAGGCTTCTCGTTTGCCACGTCGTTTGCTGATACAGCTGATGCCGGTAAAC
AGGCCGTCGGCAACACCACAGCAGCGGTACAGACGCAGCTTACGGATGCACAGAAGGCCACCGACCCGGT
GTACACGCTGCCGGAGAATTCCACCCTCGTTGGCAGTCGCGCGATGACCGCACTCCTGGGGCGCATCCCC
GTGGATGGTAAAGTGACCGACCCCTATCCCTTTAAGGTGATGATTGGCAAAGACAACCTGACGGCAAACG
GCATCGAGTTGCCTGACGTGCAGGGGGCCATTGTTTCCGGCACGGCGACGGGCGACTGGACGCTGTCATG
CGTGCGGGGCTCCATTACCAGCATCACTTTTGTCTTCAGCGACGGCACGGTCAGGACGCTGCCTTCGCCT
GACGGACAGGGGCAGAACGGAAACAGCAGTAATCAGAACAGTCAGGGCGGTAATAGCAGCAGTATTGGCT
GGTTGTCCGATGATAACGGTATTCCCTGCATCTCCGGGACGCGCAAGAGCAATGCTTCGACCTATCTGCC
GACCATCGCCGCACTTGCGGCCGCCAGTGCGGCGGGTGATGCCGTGGCGGAAAACCAGAGTACCGGCCAG
ACCAACGCTTACGGTGGCGTGACCTCAACGCTCACCGGTAATGCCGGTCAGGCCGTACTGGGTAAAGCGC
TCTCCGGCGGCATGCGTGAGACCGTTGACTGGGTGAAGGCCCGCTATGGCCAGACGTTTGATGCCATCTA
CGTGCCGCCGGGTCAGACAGTGGCTTTGCATATCACGCGCCAGCTGGCCATCGATTACGAGGAAAAAGGC
CGCAGGGTTAAATACGATTTCAGCCTGGCCGGCAGCGGCACGGGCATGGACTGA
 Primer design