SecReT4
Protein ID: 296100812
T4SS name [ID]Tfc [720]
Gene symbol-
Locus tagECL_00443
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T4SS(s) in this replicon]
Location [Strand]454668..455117 [+]
Producthypothetical protein
Component typeTfc15
UniProt IDD5CDP6
KEGG IDenc:ECL_00443
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 149 a.a.     [Download]
>gi|296100812|ref|YP_003610958.1| hypothetical protein ECL_00443 [Enterobacter cloacae subsp. cloacae ATCC 13047]
MQNDIPDTAVMRWRSLRPVTLFLTGAVALLLAGCSTSKDEMLPPGDSTMLELWNDGASATHATGESRTTL
RRPVTDSERVISRQTRDSYSRTQENEIQQTFPRLPNPDLVMYVFPHLADGNTPVPGYSTVFPFYSQVQYA
LPGERTEDL
 
Nucleotide Sequence: 450 bp     [Download]
>gi|296100371|ref|NC_014121.1|:454668-455117 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGCAAAATGATATCCCTGATACCGCTGTGATGAGGTGGCGCAGTCTGCGTCCCGTCACGCTTTTCCTGA
CCGGAGCCGTGGCACTGCTGCTTGCCGGCTGCAGCACATCAAAAGATGAGATGCTCCCGCCGGGTGACAG
CACCATGCTGGAACTGTGGAATGATGGTGCTTCAGCCACCCATGCAACCGGTGAGAGCCGGACCACCCTG
CGCCGTCCGGTTACGGACAGTGAGCGGGTTATTTCACGGCAGACCCGGGACAGCTACAGCCGCACCCAGG
AGAATGAAATCCAGCAGACGTTTCCGCGCCTGCCCAACCCCGACCTGGTGATGTACGTCTTCCCGCATCT
GGCCGACGGCAACACGCCGGTGCCCGGTTACAGCACCGTATTTCCCTTCTACAGCCAGGTACAGTACGCG
CTGCCCGGCGAGCGCACGGAGGATTTGTAA
 Primer design