SecReT4
Protein ID: 296100813
T4SS name [ID]Tfc [720]
Gene symbol-
Locus tagECL_00444
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T4SS(s) in this replicon]
Location [Strand]455117..457915 [+]
Productputative plasmid-like protein
Component typeTfc16
UniProt IDD5CDP7
KEGG IDenc:ECL_00444
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 5.6e-61, Aligned region: 49..315
AAA_10 [PF12846], Evalue: 2.3e-40, Aligned region: 508..849
Protein Sequence: 932 a.a.     [Download]
>gi|296100813|ref|YP_003610959.1| putative plasmid-like protein [Enterobacter cloacae subsp. cloacae ATCC 13047]
MAFSLFRRRAEAQEAHQYGDGPFSVNGHEPLTREGRLTRSEEAKLYETAPSIIDHIPWGEYLPEHQCILL
DDGVSVGAVYEIIPVGTEGRPDSRLEEIRDVVENALQDSLPELDTHQWVVQFYCQDESDLMVYMDKIRGY
VKPRAQGTDFTDAWLREQARHLQNVATEKGLFVDEAVTGAPWRGQIRRTRMVIYRWVESPYRDPMAPEVL
LKQVCDRLTAAMSGAGIQCQRQNGEQIHSWLLRWFNPEPTWVDKATLYRCARHTDDAPGELPLLNDFSES
LWFTRPRSDAEKGVWWFDDVAHRAVPVARLRSAPTTGHLTGEVRRGDNINAIMDLLPEGTVLVMTLVIHP
QDKLEENFARLSRDSMGENVDSLRAREDAATARTYLGNKHKLYRAAITLLIKARDLPSLDSRYLDLSSKL
LNCGLEPVNPEHDIGPLSTYMRALPMCFNPEQDRHNWYTRLMFVQHFACLAPVYGRDTGTGNPGFTFFNR
GGGPLSVDPLNKNDRTQNAHLLLFGPTGAGKSATALDKLAQMIAIYRSRIFLLEAGNSFGLAGDYFESLG
LTVHRVSIKPGKAISLAPFGDSHLLMQEKPDELIISEDALPDIDDDEDKDEKRDVLGEMEIAARLMITGG
EPAEEQRMTRADRGMIREAIMIAARSTFEAGRQMLPEDLMFALQGIARDAGMGEDGRERRTAARRARAEE
MSEALRMFTEGFEGELFNRPGTPWPEADVTIVDLGTLAREGYEAQMAVAVISLLNTINNIAEREQYSDRD
IIVSIDEAHIVTANPLMGPYATKIVKMWRKLGAWLWLFTQNLADFPDTAKKMLNMAEWWICLVMPPDEVE
QIARFKTLNSEQKAMLLSATKLPKKYTEGVILSRKVQALFRAVPPSLYLALGMTEKEEKAERRLIMNELQ
CSELEAAFHVARRLDENRGLSI
 
Nucleotide Sequence: 2799 bp     [Download]
>gi|296100371|ref|NC_014121.1|:455117-457915 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGGCCTTTTCACTTTTCCGTCGCAGGGCTGAAGCGCAGGAAGCACACCAGTACGGTGACGGGCCGTTTT
CTGTTAACGGCCATGAACCCCTGACGCGCGAGGGACGTCTGACCCGCAGCGAGGAAGCGAAGCTGTATGA
GACGGCTCCGTCCATCATCGATCACATTCCCTGGGGGGAATATCTCCCTGAACATCAGTGCATCCTGCTT
GATGACGGCGTGTCGGTCGGGGCAGTTTACGAAATCATCCCGGTGGGCACCGAGGGGCGTCCGGATTCCC
GCCTGGAGGAAATTCGCGACGTGGTCGAAAACGCCCTGCAGGACAGTCTTCCGGAGCTGGATACACATCA
GTGGGTGGTGCAGTTCTACTGTCAGGACGAGTCTGACCTGATGGTGTATATGGATAAGATCCGGGGGTAT
GTTAAGCCCCGGGCGCAGGGCACCGACTTCACCGACGCCTGGCTGAGGGAACAGGCCCGTCATCTGCAGA
ATGTGGCCACTGAAAAAGGCCTGTTTGTCGATGAGGCCGTCACCGGTGCGCCGTGGCGCGGTCAGATACG
TCGTACGCGTATGGTCATCTACCGCTGGGTGGAGTCACCGTATCGTGACCCGATGGCCCCCGAGGTGCTG
CTGAAGCAGGTCTGCGATCGCCTGACGGCCGCCATGAGCGGTGCCGGTATTCAGTGCCAGCGCCAGAACG
GCGAGCAGATCCACAGCTGGCTGCTGCGCTGGTTCAACCCTGAACCAACGTGGGTGGATAAGGCCACACT
GTATCGCTGTGCCAGACATACTGACGACGCTCCTGGCGAACTGCCGTTGCTGAATGATTTCAGTGAAAGC
CTGTGGTTCACCCGCCCCCGCAGTGATGCGGAGAAAGGCGTATGGTGGTTTGATGACGTGGCGCACAGGG
CGGTGCCGGTGGCTCGTCTGCGCAGCGCACCCACCACGGGGCACCTGACCGGCGAGGTCCGCCGTGGCGA
TAATATCAACGCCATTATGGACCTGCTGCCGGAAGGTACGGTGCTTGTCATGACGCTGGTTATCCATCCG
CAGGACAAGCTGGAGGAAAACTTTGCCCGGCTGAGTCGTGACTCGATGGGGGAGAACGTGGATTCGCTGC
GTGCCCGGGAGGATGCGGCCACCGCCCGCACTTACCTGGGTAATAAGCATAAACTGTATCGCGCGGCCAT
TACCCTGCTGATTAAAGCCCGCGACCTGCCTTCACTGGACAGTCGCTATCTCGACCTCAGCAGTAAGCTA
CTGAACTGCGGGCTGGAGCCGGTAAACCCGGAGCATGATATCGGGCCGCTCAGCACCTACATGCGTGCAT
TACCCATGTGCTTTAATCCGGAGCAGGACCGGCACAACTGGTATACCCGTCTGATGTTCGTGCAGCATTT
TGCCTGCCTGGCGCCGGTGTACGGGCGTGATACCGGCACCGGCAACCCGGGCTTTACCTTTTTTAACCGG
GGCGGTGGTCCGCTGTCCGTCGATCCCCTCAACAAAAATGACCGTACGCAGAACGCCCACCTCCTGCTGT
TTGGGCCGACCGGTGCAGGTAAATCGGCTACCGCACTTGATAAGCTGGCACAAATGATAGCCATTTACCG
TTCACGTATCTTTTTACTGGAGGCGGGTAACAGCTTCGGGCTGGCCGGAGACTACTTTGAGTCCCTGGGA
CTCACCGTTCATCGTGTCAGCATCAAGCCCGGTAAGGCCATCTCGCTGGCGCCGTTCGGTGATTCGCATC
TGCTGATGCAGGAAAAACCGGATGAACTCATTATCAGTGAAGACGCCCTGCCGGATATTGATGACGATGA
GGACAAGGATGAAAAACGTGATGTGCTGGGTGAGATGGAGATTGCAGCACGCCTGATGATTACCGGCGGC
GAGCCAGCGGAGGAGCAGAGAATGACGCGCGCCGATCGCGGGATGATCCGGGAAGCCATCATGATCGCTG
CGCGGAGTACGTTTGAGGCCGGACGGCAGATGTTGCCTGAAGATCTGATGTTTGCGCTGCAGGGCATCGC
CCGGGATGCCGGGATGGGTGAGGACGGGCGCGAAAGGCGTACGGCCGCGCGCCGGGCCCGTGCTGAGGAA
ATGTCGGAAGCGCTACGGATGTTTACCGAAGGCTTTGAAGGTGAGCTGTTTAACCGTCCGGGTACGCCGT
GGCCGGAGGCTGATGTGACCATCGTTGACCTTGGTACGCTGGCGCGCGAAGGCTATGAGGCGCAGATGGC
CGTTGCGGTGATTTCCCTGCTCAACACCATCAACAATATTGCTGAGCGCGAGCAGTACAGTGACCGGGAT
ATTATCGTGTCGATCGATGAGGCGCATATCGTGACCGCAAATCCCCTGATGGGGCCTTATGCCACCAAGA
TTGTGAAAATGTGGCGTAAGCTGGGTGCCTGGCTCTGGCTGTTCACGCAGAACCTGGCCGACTTTCCGGA
TACGGCCAAAAAGATGCTCAATATGGCGGAGTGGTGGATTTGTCTGGTGATGCCCCCTGATGAAGTGGAG
CAGATAGCGCGTTTTAAAACGCTGAACAGTGAACAGAAGGCGATGCTGTTGTCTGCCACCAAACTTCCTA
AAAAATATACGGAAGGCGTTATTTTGTCACGTAAGGTGCAGGCCCTGTTCCGTGCCGTGCCCCCGAGCCT
CTACCTTGCTCTGGGTATGACAGAAAAAGAAGAGAAAGCTGAAAGACGCCTCATTATGAATGAATTACAG
TGCAGTGAACTTGAGGCTGCGTTTCATGTTGCGCGCCGGCTTGATGAAAATCGCGGACTGAGTATCTGA
 Primer design