SecReT4
Protein ID: 296100817
T4SS name [ID]Tfc [720]
Gene symbol-
Locus tagECL_00448
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T4SS(s) in this replicon]
Location [Strand]461448..461855 [+]
Producthypothetical protein
Component typeTfc24
UniProt IDD5CDQ1
KEGG IDenc:ECL_00448
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 1.6e-40, Aligned region: 19..132
Protein Sequence: 135 a.a.     [Download]
>gi|296100817|ref|YP_003610963.1| hypothetical protein ECL_00448 [Enterobacter cloacae subsp. cloacae ATCC 13047]
MKLPVCCLAALFLTAGVRAGTVIYTDSTHPVTGNPGPEVTVVLLDAPDRLQAQLFGPLPADPAQAEQQAR
TVIGSPDFQRRQQDLAGAYAGLTRAWSLGLEKYPAVVFDDKWVVYGTSDVDVATQKLNVWKEKAQ
 
Nucleotide Sequence: 408 bp     [Download]
>gi|296100371|ref|NC_014121.1|:461448-461855 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGAAATTACCTGTCTGCTGCCTCGCAGCACTTTTCCTTACCGCCGGCGTCCGTGCCGGCACCGTCATTT
ATACCGACAGTACCCACCCGGTCACGGGCAACCCCGGTCCTGAAGTGACCGTCGTTCTGCTCGATGCCCC
TGACCGGCTGCAGGCGCAGCTGTTCGGGCCGCTCCCGGCAGACCCGGCGCAGGCTGAGCAGCAGGCGCGG
ACGGTTATCGGTTCACCGGATTTTCAGCGACGCCAGCAGGACCTTGCCGGGGCTTATGCCGGCCTCACGC
GTGCCTGGTCGCTGGGTCTTGAGAAATACCCCGCGGTGGTGTTTGACGATAAGTGGGTGGTTTACGGCAC
CTCTGACGTCGACGTTGCCACACAGAAGCTGAACGTATGGAAGGAGAAGGCACAGTGA
 Primer design