SecReT4
Protein ID: 296100818
T4SS name [ID]Tfc [720]
Gene symbol-
Locus tagECL_00449
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T4SS(s) in this replicon]
Location [Strand]461852..462823 [+]
Producthypothetical protein
Component typeTfc23
UniProt IDD5CDQ2
KEGG IDenc:ECL_00449
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 1.9e-95, Aligned region: 32..311
Protein Sequence: 323 a.a.     [Download]
>gi|296100818|ref|YP_003610964.1| hypothetical protein ECL_00449 [Enterobacter cloacae subsp. cloacae ATCC 13047]
MKMSFSRPRRLALATLMVCTGTMASVNTASLLSSATSPDCISWRISGICYWLFCTPFGCSVKTSVKVTHF
IPEAVVSAYLSPGANPWTEMSAVSSLADSTESTLLGSAAGVATGGGRQEMKAPGERKQNLHFYYGDAYGH
PATRLIGGMVPGYSCDSAATPFMPYFTSALDALAWRTGVPESLYPEALIPGQREIGSTIGGNMWGNVYPR
SGFVTQTDSYKSAAMVVQRVADIITRQGQLHVYSPLTGQRSPGYWPPDPVQENTGTKNHKWQRLSPQLSQ
SCAVFPDTGGQEAQDGNYAWALWQPYSCCKRRGQTFLYSTDFS
 
Nucleotide Sequence: 972 bp     [Download]
>gi|296100371|ref|NC_014121.1|:461852-462823 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
GTGAAAATGTCTTTCTCCCGCCCGCGCCGGCTGGCGCTGGCCACGTTAATGGTCTGCACGGGCACGATGG
CCAGCGTCAATACCGCCAGCCTGCTCTCCAGTGCCACCAGTCCGGACTGTATCAGCTGGCGCATCAGCGG
CATCTGTTACTGGCTGTTCTGCACGCCGTTCGGCTGCTCGGTGAAAACCTCCGTGAAGGTCACGCATTTT
ATTCCTGAAGCCGTGGTTTCGGCCTACCTCAGCCCGGGTGCCAATCCGTGGACCGAAATGTCGGCTGTCA
GCAGCCTGGCCGACAGCACCGAAAGCACGCTGCTCGGTAGTGCTGCAGGTGTGGCCACCGGCGGTGGCCG
TCAGGAGATGAAAGCCCCGGGTGAGCGCAAGCAGAACCTGCACTTTTACTATGGCGATGCGTATGGACAT
CCGGCCACCAGACTTATTGGCGGGATGGTCCCGGGTTATTCGTGCGACAGTGCCGCCACGCCCTTTATGC
CGTACTTCACAAGTGCTCTCGATGCACTGGCCTGGCGCACCGGCGTGCCGGAATCACTCTACCCGGAGGC
GCTTATCCCCGGACAGCGTGAAATCGGCAGTACCATCGGCGGCAATATGTGGGGCAACGTCTACCCCCGC
AGCGGCTTTGTGACCCAGACCGACAGCTACAAATCGGCGGCCATGGTGGTGCAGCGCGTGGCTGACATCA
TTACCCGCCAGGGACAACTGCATGTTTACAGCCCGCTCACCGGCCAGCGTTCGCCGGGGTACTGGCCACC
CGACCCCGTGCAGGAAAACACCGGTACGAAAAATCACAAGTGGCAGCGTCTTTCCCCACAGCTGTCGCAG
AGCTGCGCGGTGTTCCCGGACACCGGTGGACAGGAGGCTCAGGACGGCAACTACGCCTGGGCACTGTGGC
AACCGTACAGTTGTTGCAAGCGACGCGGGCAGACTTTTCTTTACAGCACCGATTTCTCATGA
 Primer design