SecReT4
Protein ID: 296100819
T4SS name [ID]Tfc [720]
Gene symbol-
Locus tagECL_00450
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T4SS(s) in this replicon]
Location [Strand]462835..464259 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDD5CDQ3
KEGG IDenc:ECL_00450
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 474 a.a.     [Download]
>gi|296100819|ref|YP_003610965.1| hypothetical protein ECL_00450 [Enterobacter cloacae subsp. cloacae ATCC 13047]
MKQQYPQRLRRPLATLALFAALSLPALAVNTSLSSDGASVSGAINDGLFYSIGGGSVISPPPSRSNMSRL
GLNDGWSSDLMCGNFDLKTTVGNQLNGITSGFKDLMGNVIQGATGAVMSMPAMAIQRANPGLYEMLTNGV
LQAGLSYDKALLNCQNMSKKLADYTVGSKWQQAAVSEEYKDIVASSGGDAVSSDQQLQKATGEEGVTWVG
GQKRGGKGQQAIQPTRDLAKAGYNMMNSLPVTSNSSVGSASCNGTACQRWPSSDDAAAAVVKVLGDRSIR
TCRETSECTSGGTDNQPGSTVAGTGFSPVLEDATKTNLEQLDKLVGGQIQPTAENLGALKTGSLVVTRGV
IQSLRDDPDKAALVQRLAGELAMADTVETALTMRRMLTTGESEPNAAEQPEAIAEGDRRIDALDRELNAL
RNEMELRKAISNNSLLTTLERQGARNQDNQLQQKAGNQDQGFSQMNQTQSSGAK
 
Nucleotide Sequence: 1425 bp     [Download]
>gi|296100371|ref|NC_014121.1|:462835-464259 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGAAACAACAGTATCCGCAGCGGCTGCGCCGCCCCCTGGCGACACTGGCACTTTTCGCCGCTCTTTCCC
TGCCTGCACTGGCCGTGAATACATCGCTTTCGTCCGATGGCGCCTCGGTCAGCGGTGCCATCAATGACGG
TCTTTTTTACTCCATTGGTGGCGGTTCAGTGATTTCCCCGCCGCCGAGCCGCAGCAATATGTCGCGACTC
GGGCTGAACGACGGCTGGAGCAGTGACCTCATGTGCGGCAACTTCGACCTGAAAACCACTGTAGGCAACC
AGCTTAACGGTATCACCAGTGGGTTTAAGGACCTGATGGGTAACGTGATTCAGGGGGCGACCGGGGCGGT
CATGAGCATGCCGGCGATGGCCATTCAGCGCGCCAACCCGGGTCTGTATGAAATGCTCACCAACGGGGTG
CTTCAGGCGGGGCTCAGTTACGACAAAGCCCTGCTGAACTGCCAGAATATGTCGAAAAAACTCGCCGATT
ACACTGTGGGCAGCAAGTGGCAGCAGGCTGCTGTATCTGAGGAGTACAAGGATATCGTGGCGTCCAGCGG
CGGGGATGCGGTCTCCAGCGACCAGCAATTGCAGAAGGCCACCGGTGAAGAAGGTGTCACCTGGGTCGGC
GGCCAGAAGCGCGGTGGTAAGGGGCAGCAGGCCATCCAGCCCACCCGGGACCTGGCGAAAGCCGGTTATA
ACATGATGAACAGCCTGCCGGTGACCAGCAACAGCAGCGTGGGCTCCGCCAGCTGCAATGGCACGGCCTG
TCAGCGATGGCCATCGTCCGATGATGCAGCCGCCGCGGTGGTGAAAGTGCTGGGTGACCGCTCCATCCGT
ACCTGCCGTGAGACCAGTGAATGCACCAGTGGTGGCACGGACAATCAGCCCGGGAGTACTGTTGCCGGCA
CCGGTTTCTCGCCGGTGCTGGAGGATGCAACGAAAACCAACCTGGAACAACTGGATAAGCTGGTCGGCGG
CCAGATCCAGCCCACCGCGGAAAATCTGGGGGCGCTCAAAACCGGCAGTCTGGTGGTGACACGCGGCGTC
ATTCAGTCGCTGCGCGATGACCCCGATAAAGCCGCTCTGGTGCAGCGTCTGGCGGGTGAGCTGGCGATGG
CCGACACCGTCGAGACCGCGCTCACCATGCGCCGCATGCTGACCACCGGTGAGTCTGAACCGAATGCCGC
CGAGCAGCCAGAGGCGATTGCCGAGGGTGACCGCCGCATCGATGCCCTGGACCGGGAACTGAATGCCCTG
CGTAACGAGATGGAGCTGCGTAAGGCCATCAGTAACAACAGCCTGCTCACCACGCTGGAACGTCAGGGTG
CCCGTAACCAGGATAACCAGCTGCAGCAGAAAGCCGGCAACCAGGACCAGGGCTTCAGCCAGATGAACCA
GACGCAATCCTCAGGAGCAAAGTGA
 Primer design