SecReT4
Protein ID: 296100821
T4SS name [ID]Tfc [720]
Gene symbol-
Locus tagECL_00452
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T4SS(s) in this replicon]
Location [Strand]464613..466157 [+]
Producthypothetical protein
Component typeTfc19
UniProt IDD5CDQ5
KEGG IDenc:ECL_00452
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 1.5e-100, Aligned region: 8..480
Protein Sequence: 514 a.a.     [Download]
>gi|296100821|ref|YP_003610967.1| hypothetical protein ECL_00452 [Enterobacter cloacae subsp. cloacae ATCC 13047]
MTANSFLEYFLILFGWVMNNAMWTILGSTGLFALPLVFKVMGVWLKVREEGADEGNKGLLALPRIEHALY
VSFVVMLFCCIPLLPVDISTIKFDSSRAKQCGVSVPTPQNSGYSGLVNDFDGRTAEVPIWWYLLHMISKG
TTQAMIASIPCGTELRQMRFDVQNTKLRDPVLLQEVQDFANQCYSRAYFRLKNSNSQLSDATINSVGWIG
SDYFLNTSGYYDYYTATTPRGQWPYDSTRDSGYPDTGQGGYPTCKTWWSDGSSGLRKRVLASFGDNTRKE
MQRSFPGTQWEEVALRWLVSPRNAGLSGDGTTYAVGSSDNVTGVVGNMTRLTSTIGLGLKQAEALPGFDA
LKQALPMIQALLQMMIITVIPVLMMFSAYEPKTVVTISFALFALQFITFWWELAGWLDDRLITILYDNMA
QQGLASSVPFANFISSTNDGWIMNLVLGMMYVVFPVFWIGMLSWIGVNLGTAISTGLEKGGSLPQKAGAE
AGRDAQKIATDKAGGALKGGLKLK
 
Nucleotide Sequence: 1545 bp     [Download]
>gi|296100371|ref|NC_014121.1|:464613-466157 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGACTGCGAACAGTTTTCTGGAGTATTTTCTCATCCTGTTCGGCTGGGTGATGAACAACGCCATGTGGA
CCATCCTCGGCAGCACGGGGCTGTTCGCCCTGCCGCTGGTCTTTAAGGTGATGGGTGTGTGGCTGAAGGT
CCGGGAGGAAGGGGCAGACGAAGGCAACAAAGGGTTGCTGGCACTGCCCCGTATCGAGCATGCGCTTTAC
GTGTCGTTTGTGGTGATGTTGTTCTGCTGCATTCCGCTGCTGCCGGTGGATATCAGTACCATTAAATTCG
ACAGTTCCCGGGCAAAACAGTGCGGTGTCAGTGTTCCCACGCCGCAGAACTCCGGTTACAGCGGACTGGT
GAACGACTTTGACGGCCGCACGGCTGAGGTGCCCATCTGGTGGTATCTGCTGCACATGATTTCGAAAGGC
ACCACGCAGGCGATGATTGCGTCCATCCCGTGCGGTACGGAGCTGCGCCAGATGCGGTTTGACGTGCAGA
ACACGAAGCTGCGTGACCCGGTATTGCTGCAGGAGGTGCAGGATTTTGCGAACCAGTGTTACTCGCGGGC
GTACTTTCGTCTCAAGAACAGCAACAGCCAGCTCAGCGATGCTACCATTAACTCGGTGGGCTGGATTGGC
AGCGACTATTTTCTGAATACGTCCGGCTATTACGATTATTACACCGCCACCACACCGAGGGGCCAGTGGC
CTTATGACAGCACGCGCGACAGCGGTTATCCGGATACCGGGCAGGGAGGCTATCCCACCTGTAAAACGTG
GTGGTCAGATGGCTCGTCCGGGCTGCGCAAGCGGGTACTGGCCAGCTTTGGTGACAACACGCGTAAGGAG
ATGCAGCGATCATTCCCGGGGACGCAGTGGGAAGAGGTCGCCCTGCGCTGGCTGGTCAGTCCGCGTAATG
CCGGCCTCTCCGGAGACGGAACGACGTATGCCGTGGGAAGTTCTGATAACGTGACCGGCGTGGTCGGTAA
TATGACACGACTGACGTCCACTATCGGGCTGGGCCTCAAGCAGGCGGAAGCGCTGCCGGGATTTGATGCG
CTGAAACAGGCGCTTCCGATGATTCAGGCGCTGCTGCAGATGATGATTATTACGGTAATACCGGTCCTGA
TGATGTTCAGTGCCTATGAGCCCAAAACGGTGGTGACGATATCATTTGCGCTGTTTGCGTTGCAGTTCAT
CACGTTCTGGTGGGAACTGGCCGGGTGGCTCGATGACCGTCTGATCACCATCCTCTACGATAATATGGCC
CAGCAGGGACTGGCCAGTTCTGTACCTTTTGCGAATTTTATCAGCTCAACCAACGACGGCTGGATCATGA
ATCTGGTGCTGGGAATGATGTATGTGGTTTTCCCGGTGTTCTGGATTGGCATGCTTAGTTGGATTGGCGT
TAATTTGGGAACTGCAATATCGACAGGTTTGGAAAAAGGTGGTTCTTTGCCACAGAAGGCTGGTGCAGAG
GCGGGTAGAGATGCCCAGAAGATTGCTACAGATAAAGCCGGAGGTGCTTTAAAAGGGGGACTTAAGCTTA
AATAG
 Primer design